Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2232277..2232915 | Replicon | chromosome |
| Accession | NZ_CP111008 | ||
| Organism | Escherichia coli strain J53-p130 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | ORI87_RS10890 | Protein ID | WP_000813794.1 |
| Coordinates | 2232739..2232915 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | ORI87_RS10885 | Protein ID | WP_001270286.1 |
| Coordinates | 2232277..2232693 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI87_RS10865 (2227429) | 2227429..2228370 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| ORI87_RS10870 (2228371) | 2228371..2229384 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| ORI87_RS10875 (2229402) | 2229402..2230547 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| ORI87_RS10880 (2230792) | 2230792..2232198 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| ORI87_RS10885 (2232277) | 2232277..2232693 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| ORI87_RS10890 (2232739) | 2232739..2232915 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| ORI87_RS10895 (2233137) | 2233137..2233367 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| ORI87_RS10900 (2233459) | 2233459..2235420 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| ORI87_RS10905 (2235493) | 2235493..2236029 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| ORI87_RS10910 (2236121) | 2236121..2237296 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T264786 WP_000813794.1 NZ_CP111008:c2232915-2232739 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT264786 WP_001270286.1 NZ_CP111008:c2232693-2232277 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|