Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1665034..1665865 | Replicon | chromosome |
| Accession | NZ_CP111008 | ||
| Organism | Escherichia coli strain J53-p130 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | ORI87_RS07995 | Protein ID | WP_000854814.1 |
| Coordinates | 1665034..1665408 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | ORI87_RS08000 | Protein ID | WP_001285584.1 |
| Coordinates | 1665497..1665865 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI87_RS07955 (1660430) | 1660430..1661596 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| ORI87_RS07960 (1661715) | 1661715..1662188 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| ORI87_RS07965 (1662386) | 1662386..1663444 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| ORI87_RS07970 (1663616) | 1663616..1663945 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| ORI87_RS07975 (1664046) | 1664046..1664180 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| ORI87_RS07980 (1664300) | 1664300..1664428 | + | 129 | Protein_1558 | transposase domain-containing protein | - |
| ORI87_RS07985 (1664717) | 1664717..1664797 | - | 81 | Protein_1559 | hypothetical protein | - |
| ORI87_RS07990 (1664843) | 1664843..1665037 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| ORI87_RS07995 (1665034) | 1665034..1665408 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| ORI87_RS08000 (1665497) | 1665497..1665865 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| ORI87_RS08005 (1665939) | 1665939..1666160 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| ORI87_RS08010 (1666223) | 1666223..1666669 | - | 447 | WP_000187523.1 | RadC family protein | - |
| ORI87_RS08015 (1666666) | 1666666..1668198 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T264779 WP_000854814.1 NZ_CP111008:c1665408-1665034 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT264779 WP_001285584.1 NZ_CP111008:c1665865-1665497 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M2E8G6 |