Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 699670..700324 | Replicon | chromosome |
Accession | NZ_CP111008 | ||
Organism | Escherichia coli strain J53-p130 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | ORI87_RS03475 | Protein ID | WP_000244777.1 |
Coordinates | 699917..700324 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | ORI87_RS03470 | Protein ID | WP_000354046.1 |
Coordinates | 699670..699936 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI87_RS03445 (694839) | 694839..695582 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
ORI87_RS03450 (695639) | 695639..697072 | - | 1434 | WP_001336277.1 | 6-phospho-beta-glucosidase BglA | - |
ORI87_RS03455 (697117) | 697117..697428 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
ORI87_RS03460 (697592) | 697592..698251 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
ORI87_RS03465 (698447) | 698447..699427 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
ORI87_RS03470 (699670) | 699670..699936 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
ORI87_RS03475 (699917) | 699917..700324 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
ORI87_RS03480 (700364) | 700364..700885 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
ORI87_RS03485 (700997) | 700997..701893 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
ORI87_RS03490 (701918) | 701918..702628 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ORI87_RS03495 (702634) | 702634..704367 | + | 1734 | WP_000813200.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T264774 WP_000244777.1 NZ_CP111008:699917-700324 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QD57 |