Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 159125..160035 Replicon plasmid p131-1
Accession NZ_CP111005
Organism Escherichia coli strain J53-p131

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag ORI86_RS23700 Protein ID WP_004026354.1
Coordinates 159565..160035 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag ORI86_RS23695 Protein ID WP_004026357.1
Coordinates 159125..159568 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI86_RS23665 (ORI86_23665) 154143..154664 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
ORI86_RS23670 (ORI86_23670) 154661..155614 + 954 Protein_175 fec operon regulator FecR -
ORI86_RS23675 (ORI86_23675) 155701..157827 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
ORI86_RS23680 (ORI86_23680) 157902..158021 + 120 Protein_177 Fe3+-citrate ABC transporter substrate-binding protein -
ORI86_RS23685 (ORI86_23685) 158202..158423 + 222 WP_004213643.1 DUF2188 domain-containing protein -
ORI86_RS23690 (ORI86_23690) 158521..159024 + 504 Protein_179 DUF4113 domain-containing protein -
ORI86_RS23695 (ORI86_23695) 159125..159568 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
ORI86_RS23700 (ORI86_23700) 159565..160035 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
ORI86_RS23705 (ORI86_23705) 160490..160678 - 189 WP_223271245.1 hypothetical protein -
ORI86_RS23710 (ORI86_23710) 161292..161552 - 261 WP_004026352.1 hypothetical protein -
ORI86_RS23715 (ORI86_23715) 162123..163304 - 1182 WP_004883380.1 IS481 family transposase -
ORI86_RS23720 (ORI86_23720) 163376..163534 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
ORI86_RS23725 (ORI86_23725) 163913..164155 - 243 WP_071826037.1 hypothetical protein -
ORI86_RS23730 (ORI86_23730) 164231..164395 - 165 WP_011154586.1 hypothetical protein -
ORI86_RS23735 (ORI86_23735) 164512..164673 - 162 WP_164507110.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB 1..256283 256283
- flank IS/Tn - - 162123..163304 1181


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T264770 WP_004026354.1 NZ_CP111005:159565-160035 [Escherichia coli]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT264770 WP_004026357.1 NZ_CP111005:159125-159568 [Escherichia coli]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References