Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
| Location | 95960..96711 | Replicon | plasmid p131-1 |
| Accession | NZ_CP111005 | ||
| Organism | Escherichia coli strain J53-p131 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | ORI86_RS23355 | Protein ID | WP_004902249.1 |
| Coordinates | 95960..96442 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A071LPN3 |
| Locus tag | ORI86_RS23360 | Protein ID | WP_004902250.1 |
| Coordinates | 96433..96711 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI86_RS23335 (ORI86_23335) | 92359..93006 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| ORI86_RS23340 (ORI86_23340) | 93033..93788 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| ORI86_RS23345 (ORI86_23345) | 93889..94281 | - | 393 | WP_045145491.1 | hypothetical protein | - |
| ORI86_RS23350 (ORI86_23350) | 94386..94925 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| ORI86_RS23355 (ORI86_23355) | 95960..96442 | - | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
| ORI86_RS23360 (ORI86_23360) | 96433..96711 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
| ORI86_RS23365 (ORI86_23365) | 96830..97042 | - | 213 | WP_266051389.1 | hypothetical protein | - |
| ORI86_RS23370 (ORI86_23370) | 97150..97491 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| ORI86_RS23375 (ORI86_23375) | 98265..98375 | + | 111 | Protein_116 | glutathione ABC transporter permease GsiC | - |
| ORI86_RS23380 (ORI86_23380) | 98459..100129 | - | 1671 | WP_004902261.1 | AMP-binding protein | - |
| ORI86_RS23385 (ORI86_23385) | 100110..101375 | - | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
| ORI86_RS23390 (ORI86_23390) | 101393..101683 | - | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA14 | iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB | 1..256283 | 256283 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T264769 WP_004902249.1 NZ_CP111005:c96442-95960 [Escherichia coli]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|