Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 52498..53168 | Replicon | plasmid p131-1 |
Accession | NZ_CP111005 | ||
Organism | Escherichia coli strain J53-p131 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | Q6U619 |
Locus tag | ORI86_RS23130 | Protein ID | WP_004213072.1 |
Coordinates | 52498..52941 (-) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q6U620 |
Locus tag | ORI86_RS23135 | Protein ID | WP_004213073.1 |
Coordinates | 52938..53168 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI86_RS23095 (ORI86_23095) | 47908..48183 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
ORI86_RS23100 (ORI86_23100) | 48246..48737 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
ORI86_RS23105 (ORI86_23105) | 48786..49706 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
ORI86_RS23110 (ORI86_23110) | 49797..50200 | + | 404 | Protein_63 | GAF domain-containing protein | - |
ORI86_RS23115 (ORI86_23115) | 50718..51354 | - | 637 | Protein_64 | mucoid phenotype regulator RmpA2 | - |
ORI86_RS23120 (ORI86_23120) | 51771..52075 | + | 305 | Protein_65 | transposase | - |
ORI86_RS23125 (ORI86_23125) | 52098..52349 | - | 252 | WP_186987481.1 | hypothetical protein | - |
ORI86_RS23130 (ORI86_23130) | 52498..52941 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ORI86_RS23135 (ORI86_23135) | 52938..53168 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
ORI86_RS23140 (ORI86_23140) | 53776..54909 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
ORI86_RS23145 (ORI86_23145) | 54925..55218 | + | 294 | WP_004213076.1 | hypothetical protein | - |
ORI86_RS23150 (ORI86_23150) | 55208..55414 | - | 207 | WP_004213077.1 | hypothetical protein | - |
ORI86_RS23155 (ORI86_23155) | 55766..56056 | + | 291 | WP_004213078.1 | hypothetical protein | - |
ORI86_RS23160 (ORI86_23160) | 56046..56945 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA14 | iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB | 1..256283 | 256283 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T264768 WP_004213072.1 NZ_CP111005:c52941-52498 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|