Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 52498..53168 Replicon plasmid p131-1
Accession NZ_CP111005
Organism Escherichia coli strain J53-p131

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag ORI86_RS23130 Protein ID WP_004213072.1
Coordinates 52498..52941 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag ORI86_RS23135 Protein ID WP_004213073.1
Coordinates 52938..53168 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI86_RS23095 (ORI86_23095) 47908..48183 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
ORI86_RS23100 (ORI86_23100) 48246..48737 + 492 WP_011251327.1 DM13 domain-containing protein -
ORI86_RS23105 (ORI86_23105) 48786..49706 + 921 WP_004213934.1 DUF1471 domain-containing protein -
ORI86_RS23110 (ORI86_23110) 49797..50200 + 404 Protein_63 GAF domain-containing protein -
ORI86_RS23115 (ORI86_23115) 50718..51354 - 637 Protein_64 mucoid phenotype regulator RmpA2 -
ORI86_RS23120 (ORI86_23120) 51771..52075 + 305 Protein_65 transposase -
ORI86_RS23125 (ORI86_23125) 52098..52349 - 252 WP_186987481.1 hypothetical protein -
ORI86_RS23130 (ORI86_23130) 52498..52941 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
ORI86_RS23135 (ORI86_23135) 52938..53168 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORI86_RS23140 (ORI86_23140) 53776..54909 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
ORI86_RS23145 (ORI86_23145) 54925..55218 + 294 WP_004213076.1 hypothetical protein -
ORI86_RS23150 (ORI86_23150) 55208..55414 - 207 WP_004213077.1 hypothetical protein -
ORI86_RS23155 (ORI86_23155) 55766..56056 + 291 WP_004213078.1 hypothetical protein -
ORI86_RS23160 (ORI86_23160) 56046..56945 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB 1..256283 256283


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T264768 WP_004213072.1 NZ_CP111005:c52941-52498 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT264768 WP_004213073.1 NZ_CP111005:c53168-52938 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References