Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1665260..1666091 | Replicon | chromosome |
| Accession | NZ_CP111004 | ||
| Organism | Escherichia coli strain J53-p131 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | ORI86_RS07995 | Protein ID | WP_000854814.1 |
| Coordinates | 1665260..1665634 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | P76364 |
| Locus tag | ORI86_RS08000 | Protein ID | WP_001285584.1 |
| Coordinates | 1665723..1666091 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI86_RS07955 (1660656) | 1660656..1661822 | + | 1167 | WP_000830156.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| ORI86_RS07960 (1661941) | 1661941..1662414 | + | 474 | WP_001105415.1 | DNA gyrase inhibitor SbmC | - |
| ORI86_RS07965 (1662612) | 1662612..1663670 | + | 1059 | WP_001200891.1 | FUSC family protein | - |
| ORI86_RS07970 (1663842) | 1663842..1664171 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| ORI86_RS07975 (1664272) | 1664272..1664406 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| ORI86_RS07980 (1664526) | 1664526..1664654 | + | 129 | Protein_1558 | transposase domain-containing protein | - |
| ORI86_RS07985 (1664943) | 1664943..1665023 | - | 81 | Protein_1559 | hypothetical protein | - |
| ORI86_RS07990 (1665069) | 1665069..1665263 | - | 195 | WP_000988600.1 | DUF5983 family protein | - |
| ORI86_RS07995 (1665260) | 1665260..1665634 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| ORI86_RS08000 (1665723) | 1665723..1666091 | - | 369 | WP_001285584.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| ORI86_RS08005 (1666165) | 1666165..1666386 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| ORI86_RS08010 (1666449) | 1666449..1666895 | - | 447 | WP_000187523.1 | RadC family protein | - |
| ORI86_RS08015 (1666892) | 1666892..1668424 | - | 1533 | WP_001350525.1 | protein YeeR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T264751 WP_000854814.1 NZ_CP111004:c1665634-1665260 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13651.52 Da Isoelectric Point: 5.9541
>AT264751 WP_001285584.1 NZ_CP111004:c1666091-1665723 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829FY50 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2H28 | |
| AlphaFold DB | A0A1M2E8G6 |