Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 143709..144619 | Replicon | plasmid p133-1 |
| Accession | NZ_CP111000 | ||
| Organism | Escherichia coli strain J53-p133 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A663AYG0 |
| Locus tag | ORI88_RS23590 | Protein ID | WP_004026354.1 |
| Coordinates | 144149..144619 (+) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A6P1V3Q9 |
| Locus tag | ORI88_RS23585 | Protein ID | WP_004026357.1 |
| Coordinates | 143709..144152 (+) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI88_RS23555 (ORI88_23555) | 138727..139248 | + | 522 | WP_004213635.1 | ferric citrate uptake sigma factor FecI | - |
| ORI88_RS23560 (ORI88_23560) | 139245..140198 | + | 954 | Protein_153 | fec operon regulator FecR | - |
| ORI88_RS23565 (ORI88_23565) | 140285..142411 | + | 2127 | WP_004213640.1 | TonB-dependent Fe(3+) dicitrate receptor FecA | - |
| ORI88_RS23570 (ORI88_23570) | 142486..142605 | + | 120 | Protein_155 | Fe3+-citrate ABC transporter substrate-binding protein | - |
| ORI88_RS23575 (ORI88_23575) | 142786..143007 | + | 222 | WP_004213643.1 | DUF2188 domain-containing protein | - |
| ORI88_RS23580 (ORI88_23580) | 143105..143608 | + | 504 | Protein_157 | DUF4113 domain-containing protein | - |
| ORI88_RS23585 (ORI88_23585) | 143709..144152 | + | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
| ORI88_RS23590 (ORI88_23590) | 144149..144619 | + | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
| ORI88_RS23595 (ORI88_23595) | 145074..145262 | - | 189 | WP_223271245.1 | hypothetical protein | - |
| ORI88_RS23600 (ORI88_23600) | 145876..146136 | - | 261 | WP_004026352.1 | hypothetical protein | - |
| ORI88_RS23605 (ORI88_23605) | 146707..147888 | - | 1182 | WP_004883380.1 | IS481 family transposase | - |
| ORI88_RS23610 (ORI88_23610) | 147960..148118 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
| ORI88_RS23615 (ORI88_23615) | 148497..148739 | - | 243 | WP_071826037.1 | hypothetical protein | - |
| ORI88_RS23620 (ORI88_23620) | 148815..148979 | - | 165 | WP_011154586.1 | hypothetical protein | - |
| ORI88_RS23625 (ORI88_23625) | 149096..149257 | - | 162 | WP_164507110.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB | 1..226559 | 226559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T264742 WP_004026354.1 NZ_CP111000:144149-144619 [Escherichia coli]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT264742 WP_004026357.1 NZ_CP111000:143709-144152 [Escherichia coli]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663AYG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V3Q9 |