Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 143709..144619 Replicon plasmid p133-1
Accession NZ_CP111000
Organism Escherichia coli strain J53-p133

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag ORI88_RS23590 Protein ID WP_004026354.1
Coordinates 144149..144619 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag ORI88_RS23585 Protein ID WP_004026357.1
Coordinates 143709..144152 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI88_RS23555 (ORI88_23555) 138727..139248 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
ORI88_RS23560 (ORI88_23560) 139245..140198 + 954 Protein_153 fec operon regulator FecR -
ORI88_RS23565 (ORI88_23565) 140285..142411 + 2127 WP_004213640.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
ORI88_RS23570 (ORI88_23570) 142486..142605 + 120 Protein_155 Fe3+-citrate ABC transporter substrate-binding protein -
ORI88_RS23575 (ORI88_23575) 142786..143007 + 222 WP_004213643.1 DUF2188 domain-containing protein -
ORI88_RS23580 (ORI88_23580) 143105..143608 + 504 Protein_157 DUF4113 domain-containing protein -
ORI88_RS23585 (ORI88_23585) 143709..144152 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
ORI88_RS23590 (ORI88_23590) 144149..144619 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
ORI88_RS23595 (ORI88_23595) 145074..145262 - 189 WP_223271245.1 hypothetical protein -
ORI88_RS23600 (ORI88_23600) 145876..146136 - 261 WP_004026352.1 hypothetical protein -
ORI88_RS23605 (ORI88_23605) 146707..147888 - 1182 WP_004883380.1 IS481 family transposase -
ORI88_RS23610 (ORI88_23610) 147960..148118 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
ORI88_RS23615 (ORI88_23615) 148497..148739 - 243 WP_071826037.1 hypothetical protein -
ORI88_RS23620 (ORI88_23620) 148815..148979 - 165 WP_011154586.1 hypothetical protein -
ORI88_RS23625 (ORI88_23625) 149096..149257 - 162 WP_164507110.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB 1..226559 226559


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T264742 WP_004026354.1 NZ_CP111000:144149-144619 [Escherichia coli]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT264742 WP_004026357.1 NZ_CP111000:143709-144152 [Escherichia coli]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References