Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ataRT/ElaA-DUF1778 |
Location | 80544..81295 | Replicon | plasmid p133-1 |
Accession | NZ_CP111000 | ||
Organism | Escherichia coli strain J53-p133 |
Toxin (Protein)
Gene name | ataT | Uniprot ID | - |
Locus tag | ORI88_RS23245 | Protein ID | WP_004902249.1 |
Coordinates | 80544..81026 (-) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | ataR | Uniprot ID | A0A071LPN3 |
Locus tag | ORI88_RS23250 | Protein ID | WP_004902250.1 |
Coordinates | 81017..81295 (-) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI88_RS23225 (ORI88_23225) | 76943..77590 | - | 648 | WP_014386537.1 | EcsC family protein | - |
ORI88_RS23230 (ORI88_23230) | 77617..78372 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
ORI88_RS23235 (ORI88_23235) | 78473..78865 | - | 393 | WP_045145491.1 | hypothetical protein | - |
ORI88_RS23240 (ORI88_23240) | 78970..79509 | - | 540 | WP_004902239.1 | hypothetical protein | - |
ORI88_RS23245 (ORI88_23245) | 80544..81026 | - | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | Toxin |
ORI88_RS23250 (ORI88_23250) | 81017..81295 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | Antitoxin |
ORI88_RS23255 (ORI88_23255) | 81414..81626 | - | 213 | WP_266051389.1 | hypothetical protein | - |
ORI88_RS23260 (ORI88_23260) | 81734..82075 | - | 342 | WP_004902257.1 | hypothetical protein | - |
ORI88_RS23265 (ORI88_23265) | 82849..82959 | + | 111 | Protein_94 | glutathione ABC transporter permease GsiC | - |
ORI88_RS23270 (ORI88_23270) | 83043..84713 | - | 1671 | WP_004902261.1 | AMP-binding protein | - |
ORI88_RS23275 (ORI88_23275) | 84694..85959 | - | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
ORI88_RS23280 (ORI88_23280) | 85977..86267 | - | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB | 1..226559 | 226559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17689.52 Da Isoelectric Point: 9.2033
>T264741 WP_004902249.1 NZ_CP111000:c81026-80544 [Escherichia coli]
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
MGMRAPESLTAEHNIAEFCCQEPALNEWLKKKALRNHSTGISRVYVVCAENTNRVIGYYCLSSGSVHRNKVPGAYRRNAP
DVIPVIVLGRLAIDQAWAGNGLGAALLKDAIYRTQNIAFQVGVRALAVHALNEEVKCFYTRFGFEPSIVNTLTLLFPIKV
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|