Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 37082..37752 Replicon plasmid p133-1
Accession NZ_CP111000
Organism Escherichia coli strain J53-p133

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag ORI88_RS23020 Protein ID WP_004213072.1
Coordinates 37082..37525 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag ORI88_RS23025 Protein ID WP_004213073.1
Coordinates 37522..37752 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI88_RS22985 (ORI88_22985) 32492..32767 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
ORI88_RS22990 (ORI88_22990) 32830..33321 + 492 WP_011251327.1 DM13 domain-containing protein -
ORI88_RS22995 (ORI88_22995) 33370..34290 + 921 WP_004213934.1 DUF1471 domain-containing protein -
ORI88_RS23000 (ORI88_23000) 34381..34784 + 404 Protein_41 GAF domain-containing protein -
ORI88_RS23005 (ORI88_23005) 35302..35938 - 637 Protein_42 mucoid phenotype regulator RmpA2 -
ORI88_RS23010 (ORI88_23010) 36355..36659 + 305 Protein_43 transposase -
ORI88_RS23015 (ORI88_23015) 36682..36933 - 252 WP_186987481.1 hypothetical protein -
ORI88_RS23020 (ORI88_23020) 37082..37525 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
ORI88_RS23025 (ORI88_23025) 37522..37752 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORI88_RS23030 (ORI88_23030) 38360..39493 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
ORI88_RS23035 (ORI88_23035) 39509..39802 + 294 WP_004213076.1 hypothetical protein -
ORI88_RS23040 (ORI88_23040) 39792..39998 - 207 WP_004213077.1 hypothetical protein -
ORI88_RS23045 (ORI88_23045) 40350..40640 + 291 WP_004213078.1 hypothetical protein -
ORI88_RS23050 (ORI88_23050) 40630..41529 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB 1..226559 226559


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T264740 WP_004213072.1 NZ_CP111000:c37525-37082 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT264740 WP_004213073.1 NZ_CP111000:c37752-37522 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References