Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1..226306 | Replicon | plasmid p133-1 |
| Accession | NZ_CP111000 | ||
| Organism | Escherichia coli strain J53-p133 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | ORI88_RS22800 | Protein ID | WP_004098919.1 |
| Coordinates | 1..483 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | ORI88_RS22795 | Protein ID | WP_004213599.1 |
| Coordinates | 226306..13 (+) | Length | -75430.666666667 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI88_RS22800 (ORI88_22800) | 1..483 | + | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| ORI88_RS22805 (ORI88_22805) | 904..2131 | + | 1228 | Protein_2 | IS3 family transposase | - |
| ORI88_RS22810 (ORI88_22810) | 2127..2522 | - | 396 | Protein_3 | IS3 family transposase | - |
| ORI88_RS22815 (ORI88_22815) | 2697..3719 | - | 1023 | WP_131079334.1 | porphobilinogen synthase | - |
| ORI88_RS22820 (ORI88_22820) | 3783..5129 | - | 1347 | WP_011154555.1 | dihydroorotase | - |
| ORI88_RS22825 (ORI88_22825) | 5126..5977 | - | 852 | WP_004214538.1 | M14 family metallocarboxypeptidase | - |
| ORI88_RS22830 (ORI88_22830) | 5970..6731 | - | 762 | Protein_7 | threonine--tRNA ligase | - |
| ORI88_RS22835 (ORI88_22835) | 6819..6971 | - | 153 | Protein_8 | TGS domain-containing protein | - |
| ORI88_RS22840 (ORI88_22840) | 7401..8225 | + | 825 | WP_004214540.1 | DUF1460 domain-containing protein | - |
| ORI88_RS22845 (ORI88_22845) | 8242..8850 | - | 609 | WP_210611585.1 | isocitrate dehydrogenase | - |
| ORI88_RS22850 (ORI88_22850) | 8913..9107 | - | 195 | WP_257677988.1 | hypothetical protein | - |
| ORI88_RS22855 (ORI88_22855) | 9237..9698 | - | 462 | Protein_12 | carbonate dehydratase | - |
| ORI88_RS22860 (ORI88_22860) | 9729..10697 | - | 969 | WP_004225014.1 | IS5 family transposase | - |
| ORI88_RS22865 (ORI88_22865) | 10961..11198 | + | 238 | Protein_14 | GTP-binding protein | - |
| ORI88_RS22870 (ORI88_22870) | 11397..12224 | + | 828 | WP_004213252.1 | ABC transporter ATP-binding protein | - |
| ORI88_RS22875 (ORI88_22875) | 12246..13202 | + | 957 | WP_004213250.1 | ABC transporter substrate-binding protein | - |
| ORI88_RS22880 (ORI88_22880) | 13202..14206 | + | 1005 | WP_004902166.1 | iron ABC transporter permease | - |
| ORI88_RS22885 (ORI88_22885) | 14375..14581 | + | 207 | Protein_18 | phosphoribosyl-AMP cyclohydrolase | - |
| ORI88_RS22890 (ORI88_22890) | 14530..14949 | + | 420 | Protein_19 | GTP-binding protein | - |
| ORI88_RS22895 (ORI88_22895) | 14869..15576 | - | 708 | WP_004213424.1 | class I SAM-dependent methyltransferase | - |
| ORI88_RS22900 (ORI88_22900) | 16039..17238 | - | 1200 | WP_004902162.1 | GTP-binding protein | - |
| ORI88_RS22905 (ORI88_22905) | 17336..17722 | + | 387 | WP_004902159.1 | hypothetical protein | - |
| ORI88_RS22910 (ORI88_22910) | 17959..18276 | + | 318 | WP_004213915.1 | c-type lysozyme inhibitor | - |
| ORI88_RS22915 (ORI88_22915) | 18627..18776 | - | 150 | Protein_24 | iron dicitrate transport regulator FecR | - |
| ORI88_RS22920 (ORI88_22920) | 18826..19335 | - | 510 | WP_004145290.1 | peptide deformylase | - |
| ORI88_RS22925 (ORI88_22925) | 19573..20060 | - | 488 | Protein_26 | IS630 family transposase | - |
| ORI88_RS22930 (ORI88_22930) | 20196..20360 | - | 165 | WP_223174999.1 | hypothetical protein | - |
| ORI88_RS22935 (ORI88_22935) | 20796..21035 | - | 240 | WP_004145299.1 | hypothetical protein | - |
| ORI88_RS22940 (ORI88_22940) | 21088..22287 | - | 1200 | WP_023302795.1 | MFS transporter | - |
| ORI88_RS22945 (ORI88_22945) | 22444..24168 | + | 1725 | WP_004213920.1 | NIS family aerobactin synthetase IucA | - |
| ORI88_RS22950 (ORI88_22950) | 24169..25116 | + | 948 | WP_004213921.1 | N(6)-hydroxylysine O-acetyltransferase IucB | - |
| ORI88_RS22955 (ORI88_22955) | 25116..26849 | + | 1734 | WP_004213922.1 | NIS family aerobactin synthetase IucC | - |
| ORI88_RS22960 (ORI88_22960) | 26853..28186 | + | 1334 | Protein_33 | NADPH-dependent L-lysine N(6)-monooxygenase | - |
| ORI88_RS22965 (ORI88_22965) | 28212..30413 | + | 2202 | WP_004213924.1 | ferric aerobactin receptor IutA | - |
| ORI88_RS22970 (ORI88_22970) | 31080..31340 | + | 261 | WP_004213925.1 | DUF1471 domain-containing protein | - |
| ORI88_RS22975 (ORI88_22975) | 31382..31942 | + | 561 | WP_004213927.1 | TetR/AcrR family transcriptional regulator | - |
| ORI88_RS22980 (ORI88_22980) | 31980..32408 | + | 429 | WP_004902152.1 | DUF417 family protein | - |
| ORI88_RS22985 (ORI88_22985) | 32492..32767 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| ORI88_RS22990 (ORI88_22990) | 32830..33321 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| ORI88_RS22995 (ORI88_22995) | 33370..34290 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| ORI88_RS23000 (ORI88_23000) | 34381..34784 | + | 404 | Protein_41 | GAF domain-containing protein | - |
| ORI88_RS23005 (ORI88_23005) | 35302..35938 | - | 637 | Protein_42 | mucoid phenotype regulator RmpA2 | - |
| ORI88_RS23010 (ORI88_23010) | 36355..36659 | + | 305 | Protein_43 | transposase | - |
| ORI88_RS23015 (ORI88_23015) | 36682..36933 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| ORI88_RS23020 (ORI88_23020) | 37082..37525 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | - |
| ORI88_RS23025 (ORI88_23025) | 37522..37752 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| ORI88_RS23030 (ORI88_23030) | 38360..39493 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| ORI88_RS23035 (ORI88_23035) | 39509..39802 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| ORI88_RS23040 (ORI88_23040) | 39792..39998 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| ORI88_RS23045 (ORI88_23045) | 40350..40640 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| ORI88_RS23050 (ORI88_23050) | 40630..41529 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
| ORI88_RS23055 (ORI88_23055) | 41578..43803 | - | 2226 | WP_004215174.1 | P-loop NTPase fold protein | - |
| ORI88_RS23060 (ORI88_23060) | 43805..44720 | - | 916 | Protein_53 | transcriptional regulator | - |
| ORI88_RS23065 (ORI88_23065) | 44791..44973 | + | 183 | WP_004225020.1 | hypothetical protein | - |
| ORI88_RS23070 (ORI88_23070) | 44992..45453 | - | 462 | WP_004215188.1 | Lrp/AsnC family transcriptional regulator | - |
| ORI88_RS23075 (ORI88_23075) | 45569..46516 | + | 948 | WP_004215186.1 | DMT family transporter | - |
| ORI88_RS23080 (ORI88_23080) | 46852..47847 | + | 996 | WP_004225018.1 | IS110 family transposase | - |
| ORI88_RS23085 (ORI88_23085) | 48053..49066 | - | 1014 | WP_004210218.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| ORI88_RS23090 (ORI88_23090) | 49179..49706 | + | 528 | WP_004210220.1 | cupin domain-containing protein | - |
| ORI88_RS23095 (ORI88_23095) | 49720..52677 | + | 2958 | WP_077250518.1 | Tn3 family transposase | - |
| ORI88_RS23100 (ORI88_23100) | 52796..53412 | + | 617 | Protein_61 | recombinase family protein | - |
| ORI88_RS23105 (ORI88_23105) | 53519..54379 | + | 861 | WP_004144375.1 | alpha/beta hydrolase | - |
| ORI88_RS23110 (ORI88_23110) | 54469..54674 | - | 206 | Protein_63 | recombinase family protein | - |
| ORI88_RS23115 (ORI88_23115) | 54671..55654 | - | 984 | Protein_64 | IS5 family transposase | - |
| ORI88_RS23120 (ORI88_23120) | 56111..56758 | + | 648 | WP_004026615.1 | HAD family hydrolase | - |
| ORI88_RS23125 (ORI88_23125) | 57094..58335 | - | 1242 | WP_001176934.1 | VWA domain-containing protein | - |
| ORI88_RS23130 (ORI88_23130) | 58420..58995 | - | 576 | WP_004026611.1 | tellurium resistance cAMP binding protein TerE | - |
| ORI88_RS23135 (ORI88_23135) | 59082..59660 | - | 579 | WP_032412822.1 | tellurium resistance membrane protein TerD | - |
| ORI88_RS23140 (ORI88_23140) | 59699..60739 | - | 1041 | WP_004026607.1 | tellurium resistance membrane protein TerC | - |
| ORI88_RS23145 (ORI88_23145) | 60763..61218 | - | 456 | WP_004026604.1 | tellurium resistance membrane protein TerB | - |
| ORI88_RS23150 (ORI88_23150) | 61241..62392 | - | 1152 | WP_023287201.1 | tellurium resistance system protein TerA | - |
| ORI88_RS23155 (ORI88_23155) | 62389..62973 | - | 585 | WP_004210240.1 | TerD family protein | - |
| ORI88_RS23160 (ORI88_23160) | 63285..64343 | + | 1059 | WP_023302789.1 | ATP-grasp domain-containing protein | - |
| ORI88_RS23165 (ORI88_23165) | 64355..65497 | + | 1143 | WP_131079327.1 | phosphoribosyltransferase domain-containing protein | - |
| ORI88_RS23170 (ORI88_23170) | 65490..66263 | + | 774 | WP_029884673.1 | hypothetical protein | - |
| ORI88_RS23175 (ORI88_23175) | 66265..67344 | + | 1080 | WP_004210251.1 | cysteine protease StiP family protein | - |
| ORI88_RS23180 (ORI88_23180) | 67344..68300 | + | 957 | WP_014386544.1 | HpcH/HpaI aldolase/citrate lyase family protein | - |
| ORI88_RS23185 (ORI88_23185) | 68311..69534 | + | 1224 | WP_029884672.1 | DUF4236 domain-containing protein | - |
| ORI88_RS23190 (ORI88_23190) | 69537..69995 | + | 459 | WP_004026591.1 | ribbon-helix-helix protein, CopG family | - |
| ORI88_RS23195 (ORI88_23195) | 70475..71113 | + | 639 | WP_004210261.1 | VWA domain-containing protein | - |
| ORI88_RS23200 (ORI88_23200) | 71138..71779 | + | 642 | WP_004026586.1 | TerD family protein | - |
| ORI88_RS23205 (ORI88_23205) | 71780..72418 | + | 639 | WP_004210266.1 | VWA domain-containing protein | - |
| ORI88_RS23210 (ORI88_23210) | 72511..73551 | + | 1041 | WP_004210269.1 | TerY-C metal binding domain-containing protein | - |
| ORI88_RS23215 (ORI88_23215) | 73551..75284 | + | 1734 | WP_032412835.1 | PP2C family serine/threonine-protein phosphatase | - |
| ORI88_RS23220 (ORI88_23220) | 75312..76811 | + | 1500 | WP_117257230.1 | lipopolysaccharide kinase InaA family protein | - |
| ORI88_RS23225 (ORI88_23225) | 76943..77590 | - | 648 | WP_014386537.1 | EcsC family protein | - |
| ORI88_RS23230 (ORI88_23230) | 77617..78372 | - | 756 | WP_004902235.1 | DUF2971 domain-containing protein | - |
| ORI88_RS23235 (ORI88_23235) | 78473..78865 | - | 393 | WP_045145491.1 | hypothetical protein | - |
| ORI88_RS23240 (ORI88_23240) | 78970..79509 | - | 540 | WP_004902239.1 | hypothetical protein | - |
| ORI88_RS23245 (ORI88_23245) | 80544..81026 | - | 483 | WP_004902249.1 | GNAT family N-acetyltransferase | - |
| ORI88_RS23250 (ORI88_23250) | 81017..81295 | - | 279 | WP_004902250.1 | DUF1778 domain-containing protein | - |
| ORI88_RS23255 (ORI88_23255) | 81414..81626 | - | 213 | WP_266051389.1 | hypothetical protein | - |
| ORI88_RS23260 (ORI88_23260) | 81734..82075 | - | 342 | WP_004902257.1 | hypothetical protein | - |
| ORI88_RS23265 (ORI88_23265) | 82849..82959 | + | 111 | Protein_94 | glutathione ABC transporter permease GsiC | - |
| ORI88_RS23270 (ORI88_23270) | 83043..84713 | - | 1671 | WP_004902261.1 | AMP-binding protein | - |
| ORI88_RS23275 (ORI88_23275) | 84694..85959 | - | 1266 | WP_004210292.1 | MSMEG_0569 family flavin-dependent oxidoreductase | - |
| ORI88_RS23280 (ORI88_23280) | 85977..86267 | - | 291 | WP_011154627.1 | MSMEG_0570 family nitrogen starvation response protein | - |
| ORI88_RS23285 (ORI88_23285) | 86279..87241 | - | 963 | WP_004210297.1 | sll0787 family AIR synthase-like protein | - |
| ORI88_RS23290 (ORI88_23290) | 87238..87801 | - | 564 | WP_004210298.1 | GNAT family N-acetyltransferase | - |
| ORI88_RS23295 (ORI88_23295) | 87812..88921 | - | 1110 | WP_004210300.1 | MSMEG_0568 family radical SAM protein | - |
| ORI88_RS23300 (ORI88_23300) | 88881..89882 | - | 1002 | WP_004902273.1 | Nit6803 family nitriliase | - |
| ORI88_RS23305 (ORI88_23305) | 89896..90378 | - | 483 | WP_004210304.1 | MSMEG_0572 family nitrogen starvation response protein | - |
| ORI88_RS23310 (ORI88_23310) | 90745..92145 | + | 1401 | WP_004210305.1 | PLP-dependent aminotransferase family protein | - |
| ORI88_RS23315 (ORI88_23315) | 92754..93068 | + | 315 | WP_004186895.1 | hypothetical protein | - |
| ORI88_RS23320 (ORI88_23320) | 93311..93793 | - | 483 | WP_004210306.1 | hypothetical protein | - |
| ORI88_RS23325 (ORI88_23325) | 95009..95893 | + | 885 | WP_004210308.1 | RepB family plasmid replication initiator protein | - |
| ORI88_RS23330 (ORI88_23330) | 96015..96824 | - | 810 | WP_266051401.1 | hypothetical protein | - |
| ORI88_RS23335 (ORI88_23335) | 97000..97833 | - | 834 | WP_004902281.1 | hypothetical protein | - |
| ORI88_RS23340 (ORI88_23340) | 98096..99064 | + | 969 | Protein_109 | IS5 family transposase | - |
| ORI88_RS23345 (ORI88_23345) | 99219..99473 | - | 255 | WP_004213836.1 | Hha/YmoA family nucleoid-associated regulatory protein | - |
| ORI88_RS23350 (ORI88_23350) | 99651..100787 | + | 1137 | WP_004213833.1 | tyrosine-type recombinase/integrase | - |
| ORI88_RS23355 (ORI88_23355) | 100853..101170 | - | 318 | WP_004213829.1 | hypothetical protein | - |
| ORI88_RS23360 (ORI88_23360) | 101322..101645 | - | 324 | WP_004197568.1 | hypothetical protein | - |
| ORI88_RS23365 (ORI88_23365) | 101930..102400 | - | 471 | WP_004902291.1 | hypothetical protein | - |
| ORI88_RS23370 (ORI88_23370) | 102397..103356 | - | 960 | WP_011154511.1 | DNA replication terminus site-binding protein | - |
| ORI88_RS23375 (ORI88_23375) | 103399..103806 | - | 408 | WP_004186937.1 | hypothetical protein | - |
| ORI88_RS23380 (ORI88_23380) | 103816..104259 | - | 444 | WP_004213821.1 | hypothetical protein | - |
| ORI88_RS23385 (ORI88_23385) | 104280..105355 | - | 1076 | Protein_118 | IS3 family transposase | - |
| ORI88_RS23390 (ORI88_23390) | 105523..106491 | + | 969 | WP_004213807.1 | IS110 family transposase | - |
| ORI88_RS23395 (ORI88_23395) | 106510..106674 | - | 165 | Protein_120 | transposase | - |
| ORI88_RS23400 (ORI88_23400) | 106760..108352 | - | 1593 | WP_004902302.1 | IS66-like element ISKox1 family transposase | - |
| ORI88_RS23405 (ORI88_23405) | 108383..108733 | - | 351 | WP_004189161.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| ORI88_RS23410 (ORI88_23410) | 108730..109170 | - | 441 | WP_004215130.1 | transposase | - |
| ORI88_RS23415 (ORI88_23415) | 109255..109549 | + | 295 | Protein_124 | DUF4113 domain-containing protein | - |
| ORI88_RS23420 (ORI88_23420) | 109628..109856 | + | 229 | Protein_125 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
| ORI88_RS23425 (ORI88_23425) | 110798..111769 | - | 972 | WP_004117790.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
| ORI88_RS23430 (ORI88_23430) | 111769..112935 | - | 1167 | WP_004211841.1 | plasmid-partitioning protein SopA | - |
| ORI88_RS23435 (ORI88_23435) | 113665..114675 | + | 1011 | WP_004211839.1 | RepB family plasmid replication initiator protein | - |
| ORI88_RS23440 (ORI88_23440) | 115497..116237 | - | 741 | Protein_129 | site-specific integrase | - |
| ORI88_RS23445 (ORI88_23445) | 116585..116858 | + | 274 | Protein_130 | IS3 family transposase | - |
| ORI88_RS23450 (ORI88_23450) | 116995..117531 | - | 537 | WP_004211835.1 | hypothetical protein | - |
| ORI88_RS23455 (ORI88_23455) | 118587..118588 | - | 2 | WP_223271235.1 | IS3 family transposase | - |
| ORI88_RS23460 (ORI88_23460) | 119263..120285 | + | 1023 | Protein_133 | IS21 family transposase | - |
| ORI88_RS23465 (ORI88_23465) | 120282..121064 | + | 783 | WP_004214667.1 | IS21-like element ISSen3 family helper ATPase IstB | - |
| ORI88_RS23470 (ORI88_23470) | 121130..121779 | - | 650 | Protein_135 | transposase | - |
| ORI88_RS23475 (ORI88_23475) | 121848..122171 | - | 324 | WP_004214672.1 | RES domain-containing protein | - |
| ORI88_RS23480 (ORI88_23480) | 122315..123283 | + | 969 | WP_004225014.1 | IS5 family transposase | - |
| ORI88_RS23485 (ORI88_23485) | 123792..124424 | + | 633 | WP_110437863.1 | mucoid phenotype regulator RmpA | - |
| ORI88_RS23490 (ORI88_23490) | 124480..124602 | + | 123 | WP_213034833.1 | mucoid phenotype synthesis protein RmpD | - |
| ORI88_RS23495 (ORI88_23495) | 124955..125356 | + | 402 | WP_220428421.1 | mucoid phenotype regulator RmpC | - |
| ORI88_RS23500 (ORI88_23500) | 125429..126331 | + | 903 | WP_004213613.1 | DMT family inner membrane transporter PEG344 | - |
| ORI88_RS23505 (ORI88_23505) | 126474..126695 | - | 222 | WP_004213615.1 | hypothetical protein | - |
| ORI88_RS23510 (ORI88_23510) | 126757..128931 | - | 2175 | WP_004213617.1 | siderophore salmochelin receptor IroN | - |
| ORI88_RS23515 (ORI88_23515) | 129391..130620 | - | 1230 | WP_004902400.1 | catecholate siderophore esterase IroD | - |
| ORI88_RS23520 (ORI88_23520) | 130725..134369 | - | 3645 | WP_023302798.1 | salmochelin/enterobactin export ABC transporter IroC | - |
| ORI88_RS23525 (ORI88_23525) | 134512..135627 | - | 1116 | WP_004213623.1 | salmochelin biosynthesis C-glycosyltransferase IroB | - |
| ORI88_RS23530 (ORI88_23530) | 135724..135935 | - | 212 | Protein_147 | IS110 family transposase | - |
| ORI88_RS23535 (ORI88_23535) | 135977..136621 | - | 645 | WP_004213626.1 | ParB N-terminal domain-containing protein | - |
| ORI88_RS23540 (ORI88_23540) | 136606..137838 | - | 1233 | WP_004213628.1 | phosphoadenosine phosphosulfate reductase | - |
| ORI88_RS23545 (ORI88_23545) | 137981..138187 | - | 207 | Protein_150 | IS66 family transposase | - |
| ORI88_RS23550 (ORI88_23550) | 138295..138501 | - | 207 | Protein_151 | IS3 family transposase | - |
| ORI88_RS23555 (ORI88_23555) | 138727..139248 | + | 522 | WP_004213635.1 | ferric citrate uptake sigma factor FecI | - |
| ORI88_RS23560 (ORI88_23560) | 139245..140198 | + | 954 | Protein_153 | fec operon regulator FecR | - |
| ORI88_RS23565 (ORI88_23565) | 140285..142411 | + | 2127 | WP_004213640.1 | TonB-dependent Fe(3+) dicitrate receptor FecA | - |
| ORI88_RS23570 (ORI88_23570) | 142486..142605 | + | 120 | Protein_155 | Fe3+-citrate ABC transporter substrate-binding protein | - |
| ORI88_RS23575 (ORI88_23575) | 142786..143007 | + | 222 | WP_004213643.1 | DUF2188 domain-containing protein | - |
| ORI88_RS23580 (ORI88_23580) | 143105..143608 | + | 504 | Protein_157 | DUF4113 domain-containing protein | - |
| ORI88_RS23585 (ORI88_23585) | 143709..144152 | + | 444 | WP_004026357.1 | DUF2384 domain-containing protein | - |
| ORI88_RS23590 (ORI88_23590) | 144149..144619 | + | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | - |
| ORI88_RS23595 (ORI88_23595) | 145074..145262 | - | 189 | WP_223271245.1 | hypothetical protein | - |
| ORI88_RS23600 (ORI88_23600) | 145876..146136 | - | 261 | WP_004026352.1 | hypothetical protein | - |
| ORI88_RS23605 (ORI88_23605) | 146707..147888 | - | 1182 | WP_004883380.1 | IS481 family transposase | - |
| ORI88_RS23610 (ORI88_23610) | 147960..148118 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
| ORI88_RS23615 (ORI88_23615) | 148497..148739 | - | 243 | WP_071826037.1 | hypothetical protein | - |
| ORI88_RS23620 (ORI88_23620) | 148815..148979 | - | 165 | WP_011154586.1 | hypothetical protein | - |
| ORI88_RS23625 (ORI88_23625) | 149096..149257 | - | 162 | WP_164507110.1 | hypothetical protein | - |
| ORI88_RS23630 (ORI88_23630) | 149645..150619 | + | 975 | WP_029884709.1 | hypothetical protein | - |
| ORI88_RS23635 (ORI88_23635) | 150686..151021 | + | 336 | WP_011154583.1 | hypothetical protein | - |
| ORI88_RS23640 (ORI88_23640) | 151370..151762 | + | 393 | WP_011154581.1 | hypothetical protein | - |
| ORI88_RS23645 (ORI88_23645) | 151829..152041 | + | 213 | WP_117090498.1 | hypothetical protein | - |
| ORI88_RS23650 (ORI88_23650) | 152190..152564 | + | 375 | WP_029884710.1 | DUF1707 domain-containing protein | - |
| ORI88_RS23655 (ORI88_23655) | 152801..153178 | - | 378 | WP_029884711.1 | hypothetical protein | - |
| ORI88_RS23660 (ORI88_23660) | 153411..153707 | + | 297 | WP_029884712.1 | hypothetical protein | - |
| ORI88_RS23665 (ORI88_23665) | 153776..154843 | + | 1068 | WP_029884713.1 | hypothetical protein | - |
| ORI88_RS23670 (ORI88_23670) | 154954..155454 | - | 501 | WP_029884714.1 | hypothetical protein | - |
| ORI88_RS23675 (ORI88_23675) | 155709..156056 | + | 348 | WP_004026338.1 | hypothetical protein | - |
| ORI88_RS23680 (ORI88_23680) | 156735..157013 | + | 279 | WP_004026336.1 | hypothetical protein | - |
| ORI88_RS23685 (ORI88_23685) | 157067..157840 | - | 774 | WP_004902228.1 | nuclease-related domain-containing protein | - |
| ORI88_RS23690 (ORI88_23690) | 157843..158979 | - | 1137 | WP_004026332.1 | S49 family peptidase | - |
| ORI88_RS23695 (ORI88_23695) | 158988..159605 | - | 618 | WP_266051273.1 | DUF4400 domain-containing protein | - |
| ORI88_RS23700 (ORI88_23700) | 159698..160395 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| ORI88_RS23705 (ORI88_23705) | 161781..162431 | - | 651 | WP_068893702.1 | DUF1173 family protein | - |
| ORI88_RS23710 (ORI88_23710) | 162464..162730 | - | 267 | WP_223175074.1 | DUF1173 family protein | - |
| ORI88_RS23715 (ORI88_23715) | 162908..163402 | + | 495 | WP_004212794.1 | thermonuclease family protein | - |
| ORI88_RS23720 (ORI88_23720) | 163739..164137 | + | 399 | WP_004212796.1 | H-NS family nucleoid-associated regulatory protein | - |
| ORI88_RS23725 (ORI88_23725) | 164455..165294 | - | 840 | WP_004212797.1 | aldo/keto reductase | - |
| ORI88_RS23730 (ORI88_23730) | 165291..165770 | - | 480 | WP_004212799.1 | cyclophilin-like fold protein | - |
| ORI88_RS23735 (ORI88_23735) | 165908..166072 | + | 165 | Protein_188 | Tn3 family transposase | - |
| ORI88_RS23740 (ORI88_23740) | 166355..166585 | - | 231 | WP_011154571.1 | hypothetical protein | - |
| ORI88_RS23745 (ORI88_23745) | 166771..168546 | - | 1776 | WP_266051281.1 | ABC transporter permease subunit | - |
| ORI88_RS23750 (ORI88_23750) | 168565..170091 | - | 1527 | WP_004212804.1 | ABC transporter substrate-binding protein | - |
| ORI88_RS23755 (ORI88_23755) | 170102..171346 | - | 1245 | WP_004212807.1 | MFS transporter | - |
| ORI88_RS23760 (ORI88_23760) | 171373..172206 | - | 834 | WP_004212808.1 | ABC transporter ATP-binding protein | - |
| ORI88_RS23765 (ORI88_23765) | 172203..173012 | - | 810 | WP_011154569.1 | ATP-binding cassette domain-containing protein | - |
| ORI88_RS23770 (ORI88_23770) | 173448..173930 | - | 483 | Protein_195 | M20/M25/M40 family metallo-hydrolase | - |
| ORI88_RS23775 (ORI88_23775) | 174626..175111 | + | 486 | WP_011154565.1 | hypothetical protein | - |
| ORI88_RS23780 (ORI88_23780) | 175208..176194 | + | 987 | Protein_197 | IS630 family transposase | - |
| ORI88_RS23785 (ORI88_23785) | 176570..177070 | - | 501 | WP_004212823.1 | transcriptional repressor | - |
| ORI88_RS23790 (ORI88_23790) | 177215..177616 | + | 402 | WP_004212825.1 | phosphoribosyl-AMP cyclohydrolase | - |
| ORI88_RS23795 (ORI88_23795) | 177653..178873 | + | 1221 | WP_004212827.1 | zinc metallochaperone GTPase ZigA | - |
| ORI88_RS23800 (ORI88_23800) | 179142..180791 | - | 1650 | WP_004212831.1 | 50S ribosome-binding GTPase | - |
| ORI88_RS23805 (ORI88_23805) | 180802..181932 | - | 1131 | WP_004212832.1 | NAD(P)-binding domain-containing protein | - |
| ORI88_RS23810 (ORI88_23810) | 182003..183384 | - | 1382 | Protein_203 | cysteine--tRNA ligase | - |
| ORI88_RS23815 (ORI88_23815) | 183464..183916 | - | 453 | WP_011251268.1 | transcriptional repressor | - |
| ORI88_RS23820 (ORI88_23820) | 184014..185213 | + | 1200 | WP_014599314.1 | GTP-binding protein | - |
| ORI88_RS23825 (ORI88_23825) | 185284..185706 | + | 423 | WP_004214547.1 | RNA polymerase-binding protein DksA | - |
| ORI88_RS23830 (ORI88_23830) | 185770..186702 | + | 933 | WP_266051295.1 | GTP cyclohydrolase FolE2 | - |
| ORI88_RS23835 (ORI88_23835) | 186743..187711 | - | 969 | WP_004225014.1 | IS5 family transposase | - |
| ORI88_RS23840 (ORI88_23840) | 187745..187876 | - | 132 | Protein_209 | carbonate dehydratase | - |
| ORI88_RS23845 (ORI88_23845) | 187925..188893 | + | 969 | WP_004225014.1 | IS5 family transposase | - |
| ORI88_RS23850 (ORI88_23850) | 189008..189175 | - | 168 | Protein_211 | IS1 family transposase | - |
| ORI88_RS23855 (ORI88_23855) | 189479..190408 | + | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| ORI88_RS23860 (ORI88_23860) | 190553..191332 | - | 780 | WP_004213560.1 | site-specific integrase | - |
| ORI88_RS23865 (ORI88_23865) | 191329..192150 | - | 822 | WP_004213562.1 | hypothetical protein | - |
| ORI88_RS23870 (ORI88_23870) | 193074..194048 | - | 975 | WP_004213565.1 | sensor domain-containing diguanylate cyclase | - |
| ORI88_RS23875 (ORI88_23875) | 194685..195593 | + | 909 | WP_023302803.1 | HNH endonuclease | - |
| ORI88_RS23880 (ORI88_23880) | 195980..196330 | - | 351 | WP_004213569.1 | DUF305 domain-containing protein | - |
| ORI88_RS23885 (ORI88_23885) | 196474..196905 | - | 432 | WP_023302802.1 | silver-binding protein SilE | - |
| ORI88_RS23890 (ORI88_23890) | 197156..198631 | - | 1476 | WP_000555737.1 | copper/silver sensor histidine kinase SilS | - |
| ORI88_RS23895 (ORI88_23895) | 198624..199304 | - | 681 | WP_004213574.1 | copper/silver response regulator transcription factor SilR | - |
| ORI88_RS23900 (ORI88_23900) | 199494..200879 | + | 1386 | WP_004213577.1 | Cu(+)/Ag(+) efflux RND transporter outer membrane channel SilC | - |
| ORI88_RS23905 (ORI88_23905) | 200908..201270 | + | 363 | WP_004213578.1 | cation efflux system protein CusF | - |
| ORI88_RS23910 (ORI88_23910) | 201384..202676 | + | 1293 | WP_004213579.1 | Cu(+)/Ag(+) efflux RND transporter periplasmic adaptor subunit SilB | - |
| ORI88_RS23915 (ORI88_23915) | 202687..205833 | + | 3147 | WP_004098958.1 | Cu(+)/Ag(+) efflux RND transporter permease subunit SilA | - |
| ORI88_RS23920 (ORI88_23920) | 205920..206360 | + | 441 | WP_000758228.1 | DUF411 domain-containing protein | - |
| ORI88_RS23925 (ORI88_23925) | 206487..208934 | + | 2448 | WP_004098955.1 | Ag(+)-translocating P-type ATPase SilP | - |
| ORI88_RS23930 (ORI88_23930) | 208975..209172 | + | 198 | WP_000843497.1 | DUF2933 domain-containing protein | - |
| ORI88_RS23935 (ORI88_23935) | 209206..209943 | - | 738 | WP_004118669.1 | peptidoglycan DD-metalloendopeptidase family protein | - |
| ORI88_RS23940 (ORI88_23940) | 210232..210681 | - | 450 | WP_001023257.1 | copper resistance protein | - |
| ORI88_RS23945 (ORI88_23945) | 210915..212732 | + | 1818 | WP_004213580.1 | multicopper oxidase PcoA | - |
| ORI88_RS23950 (ORI88_23950) | 212738..213628 | + | 891 | WP_029884201.1 | copper resistance outer membrane transporter PcoB | - |
| ORI88_RS23955 (ORI88_23955) | 213668..214048 | + | 381 | WP_000025662.1 | copper resistance system metallochaperone PcoC | - |
| ORI88_RS23960 (ORI88_23960) | 214053..214982 | + | 930 | WP_004213583.1 | copper resistance inner membrane protein PcoD | - |
| ORI88_RS23965 (ORI88_23965) | 215037..215717 | + | 681 | WP_001188930.1 | copper response regulator transcription factor PcoR | - |
| ORI88_RS23970 (ORI88_23970) | 215714..217114 | + | 1401 | WP_004152084.1 | copper resistance membrane spanning protein PcoS | - |
| ORI88_RS23975 (ORI88_23975) | 217410..217844 | - | 435 | WP_000405672.1 | Cd(II)/Pb(II)-responsive transcriptional regulator | - |
| ORI88_RS23980 (ORI88_23980) | 217930..220335 | + | 2406 | WP_004213585.1 | heavy metal translocating P-type ATPase | - |
| ORI88_RS23985 (ORI88_23985) | 220332..221408 | + | 1077 | WP_000118563.1 | signal peptidase II | - |
| ORI88_RS23990 (ORI88_23990) | 221538..222095 | + | 558 | WP_004213590.1 | recombinase family protein | - |
| ORI88_RS23995 (ORI88_23995) | 222098..225067 | + | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| ORI88_RS24000 (ORI88_24000) | 225109..225603 | + | 495 | WP_004213594.1 | hypothetical protein | - |
| ORI88_RS24005 (ORI88_24005) | 225664..225867 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| ORI88_RS24010 (ORI88_24010) | 225881..226111 | + | 231 | WP_004213598.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | iucA / iucB / iucC / iucD / iutA / rmpA / rmpA2 / rmpA / iroN / iroD / iroC / iroB | 1..226559 | 226559 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T264739 WP_004098919.1 NZ_CP111000:1-483 [Escherichia coli]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |