Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
Location | 4116168..4116763 | Replicon | chromosome |
Accession | NZ_CP110999 | ||
Organism | Escherichia coli strain J53-p133 |
Toxin (Protein)
Gene name | chpB | Uniprot ID | U9XNP6 |
Locus tag | ORI88_RS20145 | Protein ID | WP_000239577.1 |
Coordinates | 4116168..4116518 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | chpS | Uniprot ID | U9Y2K1 |
Locus tag | ORI88_RS20150 | Protein ID | WP_001223208.1 |
Coordinates | 4116512..4116763 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI88_RS20125 (4111614) | 4111614..4112636 | - | 1023 | WP_001313531.1 | ABC transporter permease | - |
ORI88_RS20130 (4112650) | 4112650..4114152 | - | 1503 | WP_000205805.1 | sugar ABC transporter ATP-binding protein | - |
ORI88_RS20135 (4114292) | 4114292..4115248 | - | 957 | WP_000265913.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
ORI88_RS20140 (4115558) | 4115558..4116088 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
ORI88_RS20145 (4116168) | 4116168..4116518 | - | 351 | WP_000239577.1 | endoribonuclease toxin ChpB | Toxin |
ORI88_RS20150 (4116512) | 4116512..4116763 | - | 252 | WP_001223208.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
ORI88_RS20155 (4116975) | 4116975..4117316 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
ORI88_RS20160 (4117319) | 4117319..4121098 | - | 3780 | WP_000060911.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12492.40 Da Isoelectric Point: 5.5572
>T264737 WP_000239577.1 NZ_CP110999:c4116518-4116168 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLHARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9XNP6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LQ26 |