Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 3886967..3887781 | Replicon | chromosome |
Accession | NZ_CP110999 | ||
Organism | Escherichia coli strain J53-p133 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | ORI88_RS19080 | Protein ID | WP_001054376.1 |
Coordinates | 3886967..3887224 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | ORI88_RS19085 | Protein ID | WP_001309181.1 |
Coordinates | 3887236..3887781 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI88_RS19055 (3882255) | 3882255..3883361 | + | 1107 | WP_001309184.1 | N-acetylneuraminate epimerase | - |
ORI88_RS19060 (3883426) | 3883426..3884406 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
ORI88_RS19065 (3884516) | 3884516..3884721 | + | 206 | Protein_3727 | HNH endonuclease | - |
ORI88_RS19070 (3884989) | 3884989..3886229 | - | 1241 | Protein_3728 | helicase YjhR | - |
ORI88_RS19075 (3886345) | 3886345..3886476 | + | 132 | WP_001309182.1 | hypothetical protein | - |
ORI88_RS19080 (3886967) | 3886967..3887224 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
ORI88_RS19085 (3887236) | 3887236..3887781 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
ORI88_RS19090 (3887837) | 3887837..3888583 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
ORI88_RS19095 (3888752) | 3888752..3888970 | + | 219 | Protein_3733 | hypothetical protein | - |
ORI88_RS19100 (3889008) | 3889008..3889124 | + | 117 | Protein_3734 | VOC family protein | - |
ORI88_RS19105 (3889369) | 3889369..3890490 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
ORI88_RS19110 (3890487) | 3890487..3890765 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
ORI88_RS19115 (3890777) | 3890777..3892090 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 3879461..3896005 | 16544 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T264735 WP_001054376.1 NZ_CP110999:3886967-3887224 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT264735 WP_001309181.1 NZ_CP110999:3887236-3887781 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|