Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2232503..2233141 | Replicon | chromosome |
Accession | NZ_CP110999 | ||
Organism | Escherichia coli strain J53-p133 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | ORI88_RS10890 | Protein ID | WP_000813794.1 |
Coordinates | 2232965..2233141 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | ORI88_RS10885 | Protein ID | WP_001270286.1 |
Coordinates | 2232503..2232919 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI88_RS10865 (2227655) | 2227655..2228596 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
ORI88_RS10870 (2228597) | 2228597..2229610 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
ORI88_RS10875 (2229628) | 2229628..2230773 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
ORI88_RS10880 (2231018) | 2231018..2232424 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
ORI88_RS10885 (2232503) | 2232503..2232919 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
ORI88_RS10890 (2232965) | 2232965..2233141 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
ORI88_RS10895 (2233363) | 2233363..2233593 | + | 231 | WP_000494244.1 | YncJ family protein | - |
ORI88_RS10900 (2233685) | 2233685..2235646 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
ORI88_RS10905 (2235719) | 2235719..2236255 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
ORI88_RS10910 (2236347) | 2236347..2237522 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T264729 WP_000813794.1 NZ_CP110999:c2233141-2232965 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT264729 WP_001270286.1 NZ_CP110999:c2232919-2232503 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|