Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 107492..108017 | Replicon | plasmid pYUXYEH3783-NDM |
Accession | NZ_CP110998 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | ORI30_RS25115 | Protein ID | WP_001159868.1 |
Coordinates | 107712..108017 (+) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | ORI30_RS25110 | Protein ID | WP_000813634.1 |
Coordinates | 107492..107710 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS25080 (102884) | 102884..103300 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | - |
ORI30_RS25085 (103297) | 103297..103527 | - | 231 | WP_001261278.1 | type II toxin-antitoxin system VapB family antitoxin | - |
ORI30_RS25090 (103792) | 103792..104292 | + | 501 | WP_000528931.1 | HEPN family nuclease | - |
ORI30_RS25095 (104305) | 104305..105078 | + | 774 | WP_000905949.1 | hypothetical protein | - |
ORI30_RS25100 (105245) | 105245..106378 | + | 1134 | WP_001542067.1 | DUF3800 domain-containing protein | - |
ORI30_RS25105 (106412) | 106412..106900 | - | 489 | WP_011254646.1 | hypothetical protein | - |
ORI30_RS25110 (107492) | 107492..107710 | + | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
ORI30_RS25115 (107712) | 107712..108017 | + | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
ORI30_RS25120 (108018) | 108018..108824 | + | 807 | WP_000016982.1 | site-specific integrase | - |
ORI30_RS25125 (109598) | 109598..110353 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
ORI30_RS25130 (110941) | 110941..112107 | + | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD | iucA / iucB / iucC / iucC / iucD / iutA | 1..168068 | 168068 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T264712 WP_001159868.1 NZ_CP110998:107712-108017 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|