Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 102884..103527 Replicon plasmid pYUXYEH3783-NDM
Accession NZ_CP110998
Organism Escherichia coli strain XYEH3783

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag ORI30_RS25080 Protein ID WP_001034046.1
Coordinates 102884..103300 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag ORI30_RS25085 Protein ID WP_001261278.1
Coordinates 103297..103527 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI30_RS25065 (98021) 98021..98437 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
ORI30_RS25070 (98434) 98434..98664 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
ORI30_RS25075 (99045) 99045..102839 + 3795 WP_001144732.1 hypothetical protein -
ORI30_RS25080 (102884) 102884..103300 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
ORI30_RS25085 (103297) 103297..103527 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORI30_RS25090 (103792) 103792..104292 + 501 WP_000528931.1 HEPN family nuclease -
ORI30_RS25095 (104305) 104305..105078 + 774 WP_000905949.1 hypothetical protein -
ORI30_RS25100 (105245) 105245..106378 + 1134 WP_001542067.1 DUF3800 domain-containing protein -
ORI30_RS25105 (106412) 106412..106900 - 489 WP_011254646.1 hypothetical protein -
ORI30_RS25110 (107492) 107492..107710 + 219 WP_000813634.1 type II toxin-antitoxin system antitoxin CcdA -
ORI30_RS25115 (107712) 107712..108017 + 306 WP_001159868.1 type II toxin-antitoxin system toxin CcdB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD iucA / iucB / iucC / iucC / iucD / iutA 1..168068 168068


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T264711 WP_001034046.1 NZ_CP110998:c103300-102884 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT264711 WP_001261278.1 NZ_CP110998:c103527-103297 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References