Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 98021..98664 Replicon plasmid pYUXYEH3783-NDM
Accession NZ_CP110998
Organism Escherichia coli strain XYEH3783

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag ORI30_RS25065 Protein ID WP_001034044.1
Coordinates 98021..98437 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag ORI30_RS25070 Protein ID WP_001261286.1
Coordinates 98434..98664 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI30_RS25050 (94423) 94423..95120 + 698 WP_223155668.1 IS1-like element IS1A family transposase -
ORI30_RS25055 (95374) 95374..96396 - 1023 WP_000361402.1 helicase UvrD -
ORI30_RS25060 (96381) 96381..97946 - 1566 WP_001128474.1 AAA family ATPase -
ORI30_RS25065 (98021) 98021..98437 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
ORI30_RS25070 (98434) 98434..98664 - 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORI30_RS25075 (99045) 99045..102839 + 3795 WP_001144732.1 hypothetical protein -
ORI30_RS25080 (102884) 102884..103300 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
ORI30_RS25085 (103297) 103297..103527 - 231 WP_001261278.1 type II toxin-antitoxin system VapB family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD iucA / iucB / iucC / iucC / iucD / iutA 1..168068 168068
- flank IS/Tn - - 94743..95120 377


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T264710 WP_001034044.1 NZ_CP110998:c98437-98021 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT264710 WP_001261286.1 NZ_CP110998:c98664-98434 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References