Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 69210..69769 Replicon plasmid pYUXYEH3783-NDM
Accession NZ_CP110998
Organism Escherichia coli strain XYEH3783

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag ORI30_RS24920 Protein ID WP_000421272.1
Coordinates 69494..69769 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag ORI30_RS24915 Protein ID WP_001387467.1
Coordinates 69210..69494 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI30_RS24885 (64281) 64281..65119 - 839 Protein_77 AadA family aminoglycoside 3''-O-nucleotidyltransferase -
ORI30_RS24890 (65268) 65268..66281 + 1014 WP_000845048.1 class 1 integron integrase IntI1 -
ORI30_RS24895 (66484) 66484..66720 + 237 Protein_79 DUF3330 domain-containing protein -
ORI30_RS24900 (66773) 66773..67477 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
ORI30_RS24905 (67538) 67538..67807 + 270 Protein_81 2-keto-3-deoxygluconate permease -
ORI30_RS24910 (67853) 67853..68605 - 753 WP_000562172.1 IclR family transcriptional regulator -
ORI30_RS24915 (69210) 69210..69494 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
ORI30_RS24920 (69494) 69494..69769 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ORI30_RS24925 (69875) 69875..70078 + 204 Protein_85 hypothetical protein -
ORI30_RS24930 (70203) 70203..70331 - 129 Protein_86 IS481 family transposase -
ORI30_RS24935 (70620) 70620..71534 - 915 WP_223429136.1 hypothetical protein -
ORI30_RS24945 (73402) 73402..73670 + 269 Protein_89 type II toxin-antitoxin system ParD family antitoxin -
ORI30_RS24950 (73657) 73657..73946 + 290 Protein_90 type II toxin-antitoxin system RelE/ParE family toxin -
ORI30_RS24955 (74013) 74013..74195 + 183 WP_042344623.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD iucA / iucB / iucC / iucC / iucD / iutA 1..168068 168068
- inside IScluster/Tn floR / tet(A) / dfrA12 / aadA2 / cmlA1 / ant(3'')-Ia / aac(3)-IId / qnrS1 / blaTEM-1B / sul3 / blaNDM-5 / sitABCD - 14172..82749 68577


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T264709 WP_000421272.1 NZ_CP110998:69494-69769 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT264709 WP_001387467.1 NZ_CP110998:69210-69494 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References