Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4097030..4097648 | Replicon | chromosome |
Accession | NZ_CP110996 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | ORI30_RS19720 | Protein ID | WP_001291435.1 |
Coordinates | 4097030..4097248 (-) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | ORI30_RS19725 | Protein ID | WP_000344800.1 |
Coordinates | 4097274..4097648 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS19685 (4092318) | 4092318..4092890 | + | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
ORI30_RS19690 (4092921) | 4092921..4093232 | - | 312 | WP_000409908.1 | MGMT family protein | - |
ORI30_RS19700 (4093611) | 4093611..4093964 | + | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
ORI30_RS19705 (4094006) | 4094006..4095556 | - | 1551 | WP_001538392.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
ORI30_RS19710 (4095720) | 4095720..4096190 | - | 471 | WP_000136192.1 | YlaC family protein | - |
ORI30_RS19715 (4096306) | 4096306..4096857 | - | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
ORI30_RS19720 (4097030) | 4097030..4097248 | - | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
ORI30_RS19725 (4097274) | 4097274..4097648 | - | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
ORI30_RS19730 (4098194) | 4098194..4101343 | - | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
ORI30_RS19735 (4101366) | 4101366..4102559 | - | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264707 WP_001291435.1 NZ_CP110996:c4097248-4097030 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT264707 WP_000344800.1 NZ_CP110996:c4097648-4097274 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |