Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3622403..3622953 Replicon chromosome
Accession NZ_CP110996
Organism Escherichia coli strain XYEH3783

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag ORI30_RS17475 Protein ID WP_001160966.1
Coordinates 3622639..3622953 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag ORI30_RS17470 Protein ID WP_000125568.1
Coordinates 3622403..3622636 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI30_RS17445 (3617476) 3617476..3617763 + 288 WP_000203741.1 ferredoxin-like protein FixX -
ORI30_RS17450 (3617822) 3617822..3619153 + 1332 WP_001183207.1 MFS transporter -
ORI30_RS17455 (3619261) 3619261..3619791 + 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
ORI30_RS17460 (3619784) 3619784..3621646 + 1863 WP_000377109.1 glutathione-regulated potassium-efflux system protein KefC -
ORI30_RS17465 (3621838) 3621838..3622317 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
ORI30_RS17470 (3622403) 3622403..3622636 + 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
ORI30_RS17475 (3622639) 3622639..3622953 + 315 WP_001160966.1 CcdB family protein Toxin
ORI30_RS17480 (3622950) 3622950..3623798 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
ORI30_RS17485 (3623805) 3623805..3624182 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
ORI30_RS17490 (3624185) 3624185..3625006 - 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
ORI30_RS17495 (3625003) 3625003..3625992 - 990 WP_000241225.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
ORI30_RS17500 (3625992) 3625992..3627278 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T264705 WP_001160966.1 NZ_CP110996:3622639-3622953 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT264705 WP_000125568.1 NZ_CP110996:3622403-3622636 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References