Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1711086..1711740 | Replicon | chromosome |
| Accession | NZ_CP110996 | ||
| Organism | Escherichia coli strain XYEH3783 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | ORI30_RS08180 | Protein ID | WP_000244781.1 |
| Coordinates | 1711086..1711493 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | ORI30_RS08185 | Protein ID | WP_000354046.1 |
| Coordinates | 1711474..1711740 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI30_RS08160 (1707043) | 1707043..1708776 | - | 1734 | WP_000813189.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ORI30_RS08165 (1708782) | 1708782..1709492 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ORI30_RS08170 (1709517) | 1709517..1710413 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| ORI30_RS08175 (1710525) | 1710525..1711046 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| ORI30_RS08180 (1711086) | 1711086..1711493 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| ORI30_RS08185 (1711474) | 1711474..1711740 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| ORI30_RS08190 (1711983) | 1711983..1712963 | + | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
| ORI30_RS08195 (1713040) | 1713040..1713699 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| ORI30_RS08200 (1713863) | 1713863..1714174 | - | 312 | WP_001182959.1 | N(4)-acetylcytidine aminohydrolase | - |
| ORI30_RS08205 (1714219) | 1714219..1715652 | + | 1434 | WP_001339296.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T264692 WP_000244781.1 NZ_CP110996:c1711493-1711086 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|