Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1555159..1555742 | Replicon | chromosome |
Accession | NZ_CP110996 | ||
Organism | Escherichia coli strain XYEH3783 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1PVD8 |
Locus tag | ORI30_RS07555 | Protein ID | WP_000254749.1 |
Coordinates | 1555159..1555494 (-) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | ORI30_RS07560 | Protein ID | WP_000581937.1 |
Coordinates | 1555494..1555742 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI30_RS07540 (1551045) | 1551045..1552343 | - | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
ORI30_RS07545 (1552431) | 1552431..1554068 | - | 1638 | WP_001774030.1 | CTP synthase (glutamine hydrolyzing) | - |
ORI30_RS07550 (1554296) | 1554296..1555087 | - | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
ORI30_RS07555 (1555159) | 1555159..1555494 | - | 336 | WP_000254749.1 | endoribonuclease MazF | Toxin |
ORI30_RS07560 (1555494) | 1555494..1555742 | - | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
ORI30_RS07565 (1555820) | 1555820..1558054 | - | 2235 | WP_000226797.1 | GTP diphosphokinase | - |
ORI30_RS07570 (1558102) | 1558102..1559403 | - | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12137.06 Da Isoelectric Point: 8.7218
>T264691 WP_000254749.1 NZ_CP110996:c1555494-1555159 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKR
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1PVD8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |