Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2871313..2872157 Replicon chromosome
Accession NZ_CP110988
Organism Escherichia coli strain XYEH3314

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag ORI32_RS14020 Protein ID WP_000854686.1
Coordinates 2871313..2871696 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag ORI32_RS14025 Protein ID WP_001285602.1
Coordinates 2871777..2872157 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI32_RS13980 (2866315) 2866315..2866806 - 492 WP_001300785.1 DUF1097 domain-containing protein -
ORI32_RS13985 (2866908) 2866908..2867462 - 555 WP_001001921.1 molecular chaperone YcdY -
ORI32_RS13990 (2867486) 2867486..2868223 - 738 WP_000283667.1 zinc-binding phosphatase -
ORI32_RS13995 (2868278) 2868278..2869216 - 939 WP_000351317.1 glyoxylate/hydroxypyruvate reductase GhrA -
ORI32_RS14005 (2869687) 2869687..2870529 - 843 WP_001431817.1 DUF4942 domain-containing protein -
ORI32_RS14010 (2870614) 2870614..2870811 - 198 WP_000839253.1 DUF957 domain-containing protein -
ORI32_RS14015 (2870828) 2870828..2871316 - 489 WP_001054233.1 DUF5983 family protein -
ORI32_RS14020 (2871313) 2871313..2871696 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
ORI32_RS14025 (2871777) 2871777..2872157 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ORI32_RS14030 (2872168) 2872168..2872851 - 684 WP_000086768.1 hypothetical protein -
ORI32_RS14035 (2872870) 2872870..2873091 - 222 WP_000692298.1 DUF987 domain-containing protein -
ORI32_RS14040 (2873154) 2873154..2873630 - 477 WP_001186726.1 RadC family protein -
ORI32_RS14045 (2873646) 2873646..2874131 - 486 WP_000214307.1 antirestriction protein -
ORI32_RS14050 (2874223) 2874223..2875041 - 819 WP_001234732.1 DUF932 domain-containing protein -
ORI32_RS14055 (2875141) 2875141..2875374 - 234 WP_001119717.1 DUF905 family protein -
ORI32_RS14060 (2875453) 2875453..2875908 - 456 WP_001504120.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T264676 WP_000854686.1 NZ_CP110988:c2871696-2871313 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT264676 WP_001285602.1 NZ_CP110988:c2872157-2871777 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References