Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2414911..2415549 | Replicon | chromosome |
Accession | NZ_CP110988 | ||
Organism | Escherichia coli strain XYEH3314 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | ORI32_RS11650 | Protein ID | WP_000813794.1 |
Coordinates | 2415373..2415549 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | ORI32_RS11645 | Protein ID | WP_001270286.1 |
Coordinates | 2414911..2415327 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI32_RS11625 (2410063) | 2410063..2411004 | - | 942 | WP_226762403.1 | ABC transporter permease | - |
ORI32_RS11630 (2411005) | 2411005..2412018 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
ORI32_RS11635 (2412036) | 2412036..2413181 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
ORI32_RS11640 (2413426) | 2413426..2414832 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
ORI32_RS11645 (2414911) | 2414911..2415327 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
ORI32_RS11650 (2415373) | 2415373..2415549 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
ORI32_RS11655 (2415771) | 2415771..2416001 | + | 231 | WP_000494244.1 | YncJ family protein | - |
ORI32_RS11660 (2416093) | 2416093..2418054 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
ORI32_RS11665 (2418127) | 2418127..2418663 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
ORI32_RS11670 (2418755) | 2418755..2419930 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T264675 WP_000813794.1 NZ_CP110988:c2415549-2415373 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT264675 WP_001270286.1 NZ_CP110988:c2415327-2414911 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|