Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1819905..1820740 | Replicon | chromosome |
| Accession | NZ_CP110988 | ||
| Organism | Escherichia coli strain XYEH3314 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | ORI32_RS08570 | Protein ID | WP_064221650.1 |
| Coordinates | 1819905..1820282 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | ORI32_RS08575 | Protein ID | WP_001295723.1 |
| Coordinates | 1820372..1820740 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI32_RS08535 (1815425) | 1815425..1815898 | + | 474 | WP_001105407.1 | DNA gyrase inhibitor SbmC | - |
| ORI32_RS08540 (1816096) | 1816096..1817154 | + | 1059 | WP_001200895.1 | FUSC family protein | - |
| ORI32_RS08545 (1817326) | 1817326..1817655 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| ORI32_RS08550 (1817756) | 1817756..1818121 | - | 366 | WP_001280454.1 | EutP/PduV family microcompartment system protein | - |
| ORI32_RS08555 (1818392) | 1818392..1818763 | - | 372 | WP_001295631.1 | IS110 family transposase | - |
| ORI32_RS08560 (1819579) | 1819579..1819659 | - | 81 | Protein_1673 | hypothetical protein | - |
| ORI32_RS08565 (1819759) | 1819759..1819908 | - | 150 | Protein_1674 | DUF5983 family protein | - |
| ORI32_RS08570 (1819905) | 1819905..1820282 | - | 378 | WP_064221650.1 | TA system toxin CbtA family protein | Toxin |
| ORI32_RS08575 (1820372) | 1820372..1820740 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ORI32_RS08580 (1820790) | 1820790..1820927 | - | 138 | WP_168787260.1 | hypothetical protein | - |
| ORI32_RS08585 (1821108) | 1821108..1822649 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| ORI32_RS08590 (1822664) | 1822664..1823410 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| ORI32_RS08595 (1823468) | 1823468..1823710 | - | 243 | WP_049067502.1 | DUF987 domain-containing protein | - |
| ORI32_RS08600 (1823773) | 1823773..1824249 | - | 477 | WP_001186775.1 | RadC family protein | - |
| ORI32_RS08605 (1824265) | 1824265..1824750 | - | 486 | WP_000849588.1 | antirestriction protein | - |
| ORI32_RS08610 (1824805) | 1824805..1825623 | - | 819 | WP_072649824.1 | DUF932 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1814109..1815329 | 1220 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14150.14 Da Isoelectric Point: 7.3249
>T264669 WP_064221650.1 NZ_CP110988:c1820282-1819905 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTQLARLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTQLARLLDQHYGLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQSGF
SACTHSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT264669 WP_001295723.1 NZ_CP110988:c1820740-1820372 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|