Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 1031922..1032505 | Replicon | chromosome |
| Accession | NZ_CP110988 | ||
| Organism | Escherichia coli strain XYEH3314 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | ORI32_RS04945 | Protein ID | WP_061349013.1 |
| Coordinates | 1032170..1032505 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | S1P3W5 |
| Locus tag | ORI32_RS04940 | Protein ID | WP_000581937.1 |
| Coordinates | 1031922..1032170 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI32_RS04930 (1028261) | 1028261..1029562 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| ORI32_RS04935 (1029610) | 1029610..1031844 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| ORI32_RS04940 (1031922) | 1031922..1032170 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| ORI32_RS04945 (1032170) | 1032170..1032505 | + | 336 | WP_061349013.1 | endoribonuclease MazF | Toxin |
| ORI32_RS04950 (1032576) | 1032576..1033367 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| ORI32_RS04955 (1033595) | 1033595..1035232 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| ORI32_RS04960 (1035320) | 1035320..1036618 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12112.07 Da Isoelectric Point: 8.2618
>T264667 WP_061349013.1 NZ_CP110988:1032170-1032505 [Escherichia coli]
MVSRYVPDMGDLIWIDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWIDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|