Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 894547..895201 | Replicon | chromosome |
Accession | NZ_CP110988 | ||
Organism | Escherichia coli strain XYEH3314 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1EEB2 |
Locus tag | ORI32_RS04320 | Protein ID | WP_000244777.1 |
Coordinates | 894794..895201 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | ORI32_RS04315 | Protein ID | WP_000354046.1 |
Coordinates | 894547..894813 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI32_RS04290 (889716) | 889716..890459 | + | 744 | WP_000951948.1 | SDR family oxidoreductase | - |
ORI32_RS04295 (890516) | 890516..891949 | - | 1434 | WP_001338826.1 | 6-phospho-beta-glucosidase BglA | - |
ORI32_RS04300 (891994) | 891994..892305 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
ORI32_RS04305 (892469) | 892469..893128 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
ORI32_RS04310 (893324) | 893324..894304 | - | 981 | WP_000886062.1 | tRNA-modifying protein YgfZ | - |
ORI32_RS04315 (894547) | 894547..894813 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
ORI32_RS04320 (894794) | 894794..895201 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
ORI32_RS04325 (895241) | 895241..895762 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
ORI32_RS04330 (895874) | 895874..896770 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
ORI32_RS04335 (896795) | 896795..897505 | + | 711 | WP_000715216.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
ORI32_RS04340 (897511) | 897511..899244 | + | 1734 | WP_000813212.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T264666 WP_000244777.1 NZ_CP110988:894794-895201 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LFV7 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6B58 | |
PDB | 1X6I | |
PDB | 1X6J | |
PDB | 6C12 | |
AlphaFold DB | A0A7U9QD57 |