Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 167304..167947 Replicon plasmid pYUXYEH3934-1
Accession NZ_CP110979
Organism Escherichia coli strain XYEH3934

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag ORI33_RS23530 Protein ID WP_000754566.1
Coordinates 167304..167720 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag ORI33_RS23535 Protein ID WP_001261276.1
Coordinates 167717..167947 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI33_RS23510 (ORI33_23505) 162317..162877 + 561 WP_001161490.1 recombinase family protein -
ORI33_RS23515 (ORI33_23510) 162881..165847 + 2967 WP_001138014.1 Tn3-like element TnAs1 family transposase -
ORI33_RS23520 (ORI33_23515) 165824..165961 - 138 WP_152935322.1 hypothetical protein -
ORI33_RS23525 (ORI33_23520) 166243..167099 - 857 Protein_194 IS3 family transposase -
ORI33_RS23530 (ORI33_23525) 167304..167720 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
ORI33_RS23535 (ORI33_23530) 167717..167947 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
ORI33_RS23540 (ORI33_23535) 167904..168158 + 255 Protein_197 hypothetical protein -
ORI33_RS23545 (ORI33_23540) 168146..168637 - 492 Protein_198 IS5-like element ISKpn26 family transposase -
ORI33_RS23550 (ORI33_23545) 168743..169447 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
ORI33_RS23555 (ORI33_23550) 169501..169710 + 210 Protein_200 IS110 family transposase -
ORI33_RS23560 (ORI33_23555) 169987..170462 - 476 Protein_201 IS1 family transposase -
ORI33_RS23565 (ORI33_23560) 170856..171884 + 1029 WP_063097364.1 tyrosine-type recombinase/integrase -
ORI33_RS23570 (ORI33_23565) 171907..172797 - 891 Protein_203 IS30-like element IS30 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid fosA3 / blaCTX-M-14 / dfrA14 / qnrS1 / tet(A) / mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 - 1..188533 188533
- inside IScluster/Tn mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 - 150029..184589 34560


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T264662 WP_000754566.1 NZ_CP110979:c167720-167304 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT264662 WP_001261276.1 NZ_CP110979:c167947-167717 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References