Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 167304..167947 | Replicon | plasmid pYUXYEH3934-1 |
| Accession | NZ_CP110979 | ||
| Organism | Escherichia coli strain XYEH3934 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | ORI33_RS23530 | Protein ID | WP_000754566.1 |
| Coordinates | 167304..167720 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | ORI33_RS23535 | Protein ID | WP_001261276.1 |
| Coordinates | 167717..167947 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI33_RS23510 (ORI33_23505) | 162317..162877 | + | 561 | WP_001161490.1 | recombinase family protein | - |
| ORI33_RS23515 (ORI33_23510) | 162881..165847 | + | 2967 | WP_001138014.1 | Tn3-like element TnAs1 family transposase | - |
| ORI33_RS23520 (ORI33_23515) | 165824..165961 | - | 138 | WP_152935322.1 | hypothetical protein | - |
| ORI33_RS23525 (ORI33_23520) | 166243..167099 | - | 857 | Protein_194 | IS3 family transposase | - |
| ORI33_RS23530 (ORI33_23525) | 167304..167720 | - | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ORI33_RS23535 (ORI33_23530) | 167717..167947 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| ORI33_RS23540 (ORI33_23535) | 167904..168158 | + | 255 | Protein_197 | hypothetical protein | - |
| ORI33_RS23545 (ORI33_23540) | 168146..168637 | - | 492 | Protein_198 | IS5-like element ISKpn26 family transposase | - |
| ORI33_RS23550 (ORI33_23545) | 168743..169447 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| ORI33_RS23555 (ORI33_23550) | 169501..169710 | + | 210 | Protein_200 | IS110 family transposase | - |
| ORI33_RS23560 (ORI33_23555) | 169987..170462 | - | 476 | Protein_201 | IS1 family transposase | - |
| ORI33_RS23565 (ORI33_23560) | 170856..171884 | + | 1029 | WP_063097364.1 | tyrosine-type recombinase/integrase | - |
| ORI33_RS23570 (ORI33_23565) | 171907..172797 | - | 891 | Protein_203 | IS30-like element IS30 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | fosA3 / blaCTX-M-14 / dfrA14 / qnrS1 / tet(A) / mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 | - | 1..188533 | 188533 | |
| - | inside | IScluster/Tn | mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 | - | 150029..184589 | 34560 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T264662 WP_000754566.1 NZ_CP110979:c167720-167304 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |