Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 12225..12823 | Replicon | plasmid pYUXYEH3934-1 |
| Accession | NZ_CP110979 | ||
| Organism | Escherichia coli strain XYEH3934 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | ORI33_RS22630 | Protein ID | WP_032187669.1 |
| Coordinates | 12225..12602 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | L4J1C0 |
| Locus tag | ORI33_RS22635 | Protein ID | WP_001603498.1 |
| Coordinates | 12602..12823 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI33_RS22605 (ORI33_22600) | 7237..7590 | + | 354 | WP_161953766.1 | hypothetical protein | - |
| ORI33_RS22610 (ORI33_22605) | 7643..8410 | - | 768 | WP_001711193.1 | hypothetical protein | - |
| ORI33_RS22615 (ORI33_22610) | 8693..9418 | + | 726 | WP_032187666.1 | hypothetical protein | - |
| ORI33_RS22620 (ORI33_22615) | 9479..10819 | + | 1341 | WP_097296309.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| ORI33_RS22625 (ORI33_22620) | 10976..12091 | + | 1116 | WP_032187668.1 | DNA primase | - |
| ORI33_RS22630 (ORI33_22625) | 12225..12602 | - | 378 | WP_032187669.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| ORI33_RS22635 (ORI33_22630) | 12602..12823 | - | 222 | WP_001603498.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| ORI33_RS22640 (ORI33_22635) | 13008..14018 | - | 1011 | WP_032187670.1 | fimbrial protein | - |
| ORI33_RS22645 (ORI33_22640) | 14029..16515 | - | 2487 | WP_032187671.1 | fimbrial biogenesis outer membrane usher protein | - |
| ORI33_RS22650 (ORI33_22645) | 16533..17213 | - | 681 | WP_032187672.1 | fimbrial assembly chaperone | - |
| ORI33_RS22655 (ORI33_22650) | 17269..17817 | - | 549 | WP_032187673.1 | fimbrial protein YehD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | fosA3 / blaCTX-M-14 / dfrA14 / qnrS1 / tet(A) / mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 | - | 1..188533 | 188533 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13465.18 Da Isoelectric Point: 6.2257
>T264661 WP_032187669.1 NZ_CP110979:c12602-12225 [Escherichia coli]
MRHISPEELTAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
MRHISPEELTAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|