Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 12225..12823 Replicon plasmid pYUXYEH3934-1
Accession NZ_CP110979
Organism Escherichia coli strain XYEH3934

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag ORI33_RS22630 Protein ID WP_032187669.1
Coordinates 12225..12602 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID L4J1C0
Locus tag ORI33_RS22635 Protein ID WP_001603498.1
Coordinates 12602..12823 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORI33_RS22605 (ORI33_22600) 7237..7590 + 354 WP_161953766.1 hypothetical protein -
ORI33_RS22610 (ORI33_22605) 7643..8410 - 768 WP_001711193.1 hypothetical protein -
ORI33_RS22615 (ORI33_22610) 8693..9418 + 726 WP_032187666.1 hypothetical protein -
ORI33_RS22620 (ORI33_22615) 9479..10819 + 1341 WP_097296309.1 DnaB-like helicase C-terminal domain-containing protein -
ORI33_RS22625 (ORI33_22620) 10976..12091 + 1116 WP_032187668.1 DNA primase -
ORI33_RS22630 (ORI33_22625) 12225..12602 - 378 WP_032187669.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
ORI33_RS22635 (ORI33_22630) 12602..12823 - 222 WP_001603498.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
ORI33_RS22640 (ORI33_22635) 13008..14018 - 1011 WP_032187670.1 fimbrial protein -
ORI33_RS22645 (ORI33_22640) 14029..16515 - 2487 WP_032187671.1 fimbrial biogenesis outer membrane usher protein -
ORI33_RS22650 (ORI33_22645) 16533..17213 - 681 WP_032187672.1 fimbrial assembly chaperone -
ORI33_RS22655 (ORI33_22650) 17269..17817 - 549 WP_032187673.1 fimbrial protein YehD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid fosA3 / blaCTX-M-14 / dfrA14 / qnrS1 / tet(A) / mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 - 1..188533 188533


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-122)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13465.18 Da        Isoelectric Point: 6.2257

>T264661 WP_032187669.1 NZ_CP110979:c12602-12225 [Escherichia coli]
MRHISPEELTAIHDANISRYGGLPGMSDSGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVYDSPELAELTVGAATGEVSVSTVVATLRRLYGTA

Download         Length: 378 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8190.24 Da        Isoelectric Point: 6.3159

>AT264661 WP_001603498.1 NZ_CP110979:c12823-12602 [Escherichia coli]
MQSINFRTARSNLTEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDTTNKKLVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB L4J1C0

References