Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 5448..6246 | Replicon | plasmid pYUXYEH3934-1 |
| Accession | NZ_CP110979 | ||
| Organism | Escherichia coli strain XYEH3934 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | - |
| Locus tag | ORI33_RS22590 | Protein ID | WP_032187665.1 |
| Coordinates | 5448..5969 (-) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A141BRA2 |
| Locus tag | ORI33_RS22595 | Protein ID | WP_001711191.1 |
| Coordinates | 5977..6246 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI33_RS22555 (ORI33_22550) | 1527..2231 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| ORI33_RS22560 (ORI33_22555) | 2281..2373 | + | 93 | Protein_2 | tail fiber protein | - |
| ORI33_RS22565 (ORI33_22560) | 2370..3272 | + | 903 | WP_053291286.1 | macro domain-containing protein | - |
| ORI33_RS22570 (ORI33_22565) | 3281..3862 | + | 582 | WP_063122786.1 | tail fiber assembly protein | - |
| ORI33_RS22575 (ORI33_22570) | 3996..4319 | + | 324 | WP_001711185.1 | hypothetical protein | - |
| ORI33_RS22580 (ORI33_22575) | 4333..5025 | + | 693 | WP_024172707.1 | membrane protein | - |
| ORI33_RS22585 (ORI33_22580) | 5028..5279 | + | 252 | WP_023135660.1 | hypothetical protein | - |
| ORI33_RS22590 (ORI33_22585) | 5448..5969 | - | 522 | WP_032187665.1 | GNAT family N-acetyltransferase | Toxin |
| ORI33_RS22595 (ORI33_22590) | 5977..6246 | - | 270 | WP_001711191.1 | DUF1778 domain-containing protein | Antitoxin |
| ORI33_RS22600 (ORI33_22595) | 6566..7231 | + | 666 | WP_023135658.1 | AAA family ATPase | - |
| ORI33_RS22605 (ORI33_22600) | 7237..7590 | + | 354 | WP_161953766.1 | hypothetical protein | - |
| ORI33_RS22610 (ORI33_22605) | 7643..8410 | - | 768 | WP_001711193.1 | hypothetical protein | - |
| ORI33_RS22615 (ORI33_22610) | 8693..9418 | + | 726 | WP_032187666.1 | hypothetical protein | - |
| ORI33_RS22620 (ORI33_22615) | 9479..10819 | + | 1341 | WP_097296309.1 | DnaB-like helicase C-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | fosA3 / blaCTX-M-14 / dfrA14 / qnrS1 / tet(A) / mef(B) / sul3 / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 | - | 1..188533 | 188533 | |
| - | flank | IS/Tn | - | - | 1527..2231 | 704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19345.11 Da Isoelectric Point: 7.7881
>T264660 WP_032187665.1 NZ_CP110979:c5969-5448 [Escherichia coli]
VSNTTIEIFSGENDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRNVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
VSNTTIEIFSGENDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEEIPKVLGYYTLSGSCFEKETLPSKSQQ
KKVPYRNVPSITLGRLALDKSLQGQGLGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKARAFYKSLGFIQLVGNNDRSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|