Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
| Location | 3475206..3476043 | Replicon | chromosome |
| Accession | NZ_CP110978 | ||
| Organism | Escherichia coli strain XYEH3934 | ||
Toxin (Protein)
| Gene name | itaT | Uniprot ID | - |
| Locus tag | ORI33_RS16705 | Protein ID | WP_112978798.1 |
| Coordinates | 3475501..3476043 (+) | Length | 181 a.a. |
Antitoxin (Protein)
| Gene name | itaR | Uniprot ID | I2UQS9 |
| Locus tag | ORI33_RS16700 | Protein ID | WP_001297137.1 |
| Coordinates | 3475206..3475517 (+) | Length | 104 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI33_RS16675 (3470226) | 3470226..3471173 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
| ORI33_RS16680 (3471195) | 3471195..3473186 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
| ORI33_RS16685 (3473176) | 3473176..3473790 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
| ORI33_RS16690 (3473790) | 3473790..3474119 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
| ORI33_RS16695 (3474131) | 3474131..3475021 | + | 891 | WP_000971336.1 | heme o synthase | - |
| ORI33_RS16700 (3475206) | 3475206..3475517 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
| ORI33_RS16705 (3475501) | 3475501..3476043 | + | 543 | WP_112978798.1 | GNAT family N-acetyltransferase | Toxin |
| ORI33_RS16710 (3476099) | 3476099..3477034 | - | 936 | WP_096310067.1 | tetratricopeptide repeat protein | - |
| ORI33_RS16715 (3477442) | 3477442..3478806 | + | 1365 | WP_001000978.1 | MFS transporter | - |
| ORI33_RS16720 (3478934) | 3478934..3479425 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
| ORI33_RS16725 (3479593) | 3479593..3480504 | + | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19776.97 Da Isoelectric Point: 8.3395
>T264654 WP_112978798.1 NZ_CP110978:3475501-3476043 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGAYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGAYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|