Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3024801..3025455 | Replicon | chromosome |
| Accession | NZ_CP110978 | ||
| Organism | Escherichia coli strain XYEH3934 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | ORI33_RS14565 | Protein ID | WP_106408893.1 |
| Coordinates | 3024801..3025136 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | ORI33_RS14570 | Protein ID | WP_001280945.1 |
| Coordinates | 3025126..3025455 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORI33_RS14545 (3020754) | 3020754..3021380 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| ORI33_RS14550 (3021377) | 3021377..3022492 | - | 1116 | WP_000554946.1 | aldose sugar dehydrogenase YliI | - |
| ORI33_RS14555 (3022603) | 3022603..3022986 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| ORI33_RS14560 (3023199) | 3023199..3024524 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| ORI33_RS14565 (3024801) | 3024801..3025136 | + | 336 | WP_106408893.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| ORI33_RS14570 (3025126) | 3025126..3025455 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| ORI33_RS14575 (3025525) | 3025525..3026853 | - | 1329 | WP_000086877.1 | GGDEF domain-containing protein | - |
| ORI33_RS14580 (3026861) | 3026861..3029203 | - | 2343 | WP_001400151.1 | EAL domain-containing protein | - |
| ORI33_RS14585 (3029381) | 3029381..3030292 | - | 912 | WP_001236042.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12354.14 Da Isoelectric Point: 6.4754
>T264652 WP_106408893.1 NZ_CP110978:3024801-3025136 [Escherichia coli]
IHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSGLSSKGTKEIEDDELAAY
KKMANAFLAFSNKQIEDLIETGFLIEVKNER
IHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSGLSSKGTKEIEDDELAAY
KKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|