Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 49622..50457 | Replicon | chromosome |
Accession | NZ_CP110978 | ||
Organism | Escherichia coli strain XYEH3934 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A2Y0VZS4 |
Locus tag | ORI33_RS00255 | Protein ID | WP_032304079.1 |
Coordinates | 49622..49999 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A369FMF5 |
Locus tag | ORI33_RS00260 | Protein ID | WP_024188924.1 |
Coordinates | 50089..50457 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ORI33_RS00225 (44990) | 44990..45913 | - | 924 | WP_000535960.1 | carboxylate/amino acid/amine transporter | - |
ORI33_RS00230 (46024) | 46024..47178 | - | 1155 | WP_063625243.1 | sugar efflux transporter | - |
ORI33_RS00235 (47605) | 47605..47766 | - | 162 | Protein_46 | virulence RhuM family protein | - |
ORI33_RS00240 (47998) | 47998..48843 | - | 846 | WP_000065752.1 | DUF4942 domain-containing protein | - |
ORI33_RS00245 (48928) | 48928..49125 | - | 198 | WP_000839243.1 | DUF957 domain-containing protein | - |
ORI33_RS00250 (49137) | 49137..49625 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
ORI33_RS00255 (49622) | 49622..49999 | - | 378 | WP_032304079.1 | TA system toxin CbtA family protein | Toxin |
ORI33_RS00260 (50089) | 50089..50457 | - | 369 | WP_024188924.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ORI33_RS00265 (50531) | 50531..50752 | - | 222 | WP_073544043.1 | DUF987 domain-containing protein | - |
ORI33_RS00270 (50821) | 50821..51297 | - | 477 | WP_143359950.1 | RadC family protein | - |
ORI33_RS00275 (51313) | 51313..51798 | - | 486 | WP_000214415.1 | antirestriction protein | - |
ORI33_RS00280 (51890) | 51890..52708 | - | 819 | WP_072643846.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14102.08 Da Isoelectric Point: 7.9094
>T264640 WP_032304079.1 NZ_CP110978:c49999-49622 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQLGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2Y0VZS4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A369FMF5 |