Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 35772..36415 | Replicon | plasmid pIT-424-FIA13 |
| Accession | NZ_CP110970 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-424/19 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | NPX97_RS28740 | Protein ID | WP_001044770.1 |
| Coordinates | 35772..36188 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | NPX97_RS28745 | Protein ID | WP_001261282.1 |
| Coordinates | 36185..36415 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX97_RS28705 (NPX97_28705) | 31314..31550 | - | 237 | WP_000993386.1 | broad-spectrum mercury transporter MerE | - |
| NPX97_RS28710 (NPX97_28710) | 31547..31909 | - | 363 | WP_001277456.1 | mercury resistance co-regulator MerD | - |
| NPX97_RS28715 (NPX97_28715) | 31927..33621 | - | 1695 | WP_000105636.1 | mercury(II) reductase | - |
| NPX97_RS28720 (NPX97_28720) | 33673..34095 | - | 423 | WP_001340589.1 | organomercurial transporter MerC | - |
| NPX97_RS28725 (NPX97_28725) | 34131..34241 | - | 111 | Protein_33 | mercuric transport protein periplasmic component | - |
| NPX97_RS28735 (NPX97_28735) | 35009..35698 | - | 690 | Protein_35 | AAA family ATPase | - |
| NPX97_RS28740 (NPX97_28740) | 35772..36188 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPX97_RS28745 (NPX97_28745) | 36185..36415 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NPX97_RS28750 (NPX97_28750) | 36372..36833 | + | 462 | WP_072202616.1 | hypothetical protein | - |
| NPX97_RS28755 (NPX97_28755) | 36977..37327 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| NPX97_RS28760 (NPX97_28760) | 37378..38121 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| NPX97_RS28765 (NPX97_28765) | 38118..38894 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| NPX97_RS28770 (NPX97_28770) | 38952..39209 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| NPX97_RS28775 (NPX97_28775) | 39338..39442 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| NPX97_RS28780 (NPX97_28780) | 39977..40843 | + | 867 | WP_004118283.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | mph(E) / msr(E) / armA / blaKPC-3 / blaTEM-1A | - | 1..73575 | 73575 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T264637 WP_001044770.1 NZ_CP110970:c36188-35772 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |