Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 35772..36415 Replicon plasmid pIT-424-FIA13
Accession NZ_CP110970
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-424/19

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NPX97_RS28740 Protein ID WP_001044770.1
Coordinates 35772..36188 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NPX97_RS28745 Protein ID WP_001261282.1
Coordinates 36185..36415 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPX97_RS28705 (NPX97_28705) 31314..31550 - 237 WP_000993386.1 broad-spectrum mercury transporter MerE -
NPX97_RS28710 (NPX97_28710) 31547..31909 - 363 WP_001277456.1 mercury resistance co-regulator MerD -
NPX97_RS28715 (NPX97_28715) 31927..33621 - 1695 WP_000105636.1 mercury(II) reductase -
NPX97_RS28720 (NPX97_28720) 33673..34095 - 423 WP_001340589.1 organomercurial transporter MerC -
NPX97_RS28725 (NPX97_28725) 34131..34241 - 111 Protein_33 mercuric transport protein periplasmic component -
NPX97_RS28735 (NPX97_28735) 35009..35698 - 690 Protein_35 AAA family ATPase -
NPX97_RS28740 (NPX97_28740) 35772..36188 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NPX97_RS28745 (NPX97_28745) 36185..36415 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPX97_RS28750 (NPX97_28750) 36372..36833 + 462 WP_072202616.1 hypothetical protein -
NPX97_RS28755 (NPX97_28755) 36977..37327 + 351 WP_000493378.1 hypothetical protein -
NPX97_RS28760 (NPX97_28760) 37378..38121 + 744 WP_000129823.1 hypothetical protein -
NPX97_RS28765 (NPX97_28765) 38118..38894 + 777 WP_000015958.1 site-specific integrase -
NPX97_RS28770 (NPX97_28770) 38952..39209 - 258 WP_000764642.1 hypothetical protein -
NPX97_RS28775 (NPX97_28775) 39338..39442 - 105 WP_032409716.1 hypothetical protein -
NPX97_RS28780 (NPX97_28780) 39977..40843 + 867 WP_004118283.1 replication initiation protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid mph(E) / msr(E) / armA / blaKPC-3 / blaTEM-1A - 1..73575 73575


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T264637 WP_001044770.1 NZ_CP110970:c36188-35772 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT264637 WP_001261282.1 NZ_CP110970:c36415-36185 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References