Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
| Location | 5362184..5362809 | Replicon | chromosome |
| Accession | NZ_CP110967 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-424/19 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | R4Y4A3 |
| Locus tag | NPX97_RS26515 | Protein ID | WP_002882817.1 |
| Coordinates | 5362184..5362567 (-) | Length | 128 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | J2DFR0 |
| Locus tag | NPX97_RS26520 | Protein ID | WP_004150355.1 |
| Coordinates | 5362567..5362809 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPX97_RS26500 (NPX97_26500) | 5359550..5360452 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
| NPX97_RS26505 (NPX97_26505) | 5360449..5361084 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
| NPX97_RS26510 (NPX97_26510) | 5361081..5362010 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
| NPX97_RS26515 (NPX97_26515) | 5362184..5362567 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NPX97_RS26520 (NPX97_26520) | 5362567..5362809 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
| NPX97_RS26525 (NPX97_26525) | 5363014..5363931 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
| NPX97_RS26530 (NPX97_26530) | 5363945..5364886 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
| NPX97_RS26535 (NPX97_26535) | 5364931..5365368 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
| NPX97_RS26540 (NPX97_26540) | 5365365..5366225 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
| NPX97_RS26545 (NPX97_26545) | 5366219..5366818 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T264634 WP_002882817.1 NZ_CP110967:c5362567-5362184 [Klebsiella pneumoniae subsp. pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GPK8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GGU9 |