Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53404..54140 Replicon plasmid pIT-395-FIIFIB
Accession NZ_CP110958
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-395/19

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NPY03_RS26680 Protein ID WP_003026803.1
Coordinates 53658..54140 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NPY03_RS26675 Protein ID WP_003026799.1
Coordinates 53404..53670 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY03_RS26630 (NPY03_26630) 49466..49828 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
NPY03_RS26635 (NPY03_26635) 49878..50228 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NPY03_RS26640 (NPY03_26640) 50586..50855 + 270 WP_004152102.1 hypothetical protein -
NPY03_RS26645 (NPY03_26645) 50843..51418 + 576 WP_004152103.1 hypothetical protein -
NPY03_RS26650 (NPY03_26650) 51449..51943 + 495 WP_004152104.1 DNA-binding protein -
NPY03_RS26655 (NPY03_26655) 51987..52355 + 369 WP_004152105.1 hypothetical protein -
NPY03_RS26660 (NPY03_26660) 52389..52592 + 204 WP_004152106.1 HHA domain-containing protein -
NPY03_RS26665 (NPY03_26665) 52641..52898 + 258 WP_004152107.1 hypothetical protein -
NPY03_RS26670 (NPY03_26670) 52974..53228 + 255 WP_004152108.1 hypothetical protein -
NPY03_RS26675 (NPY03_26675) 53404..53670 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NPY03_RS26680 (NPY03_26680) 53658..54140 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NPY03_RS26685 (NPY03_26685) 54352..55698 + 1347 WP_020314316.1 ISNCY family transposase -
NPY03_RS26690 (NPY03_26690) 55859..55990 + 132 WP_004218042.1 hypothetical protein -
NPY03_RS26695 (NPY03_26695) 56199..57364 - 1166 Protein_58 IS3 family transposase -
NPY03_RS26700 (NPY03_26700) 57541..58503 - 963 WP_004152113.1 zinc metalloprotease HtpX -
NPY03_RS26705 (NPY03_26705) 58490..58978 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid aph(3')-Ia / mph(A) / sul1 / qacE / aadA2 / dfrA12 / catA1 - 1..203817 203817


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T264604 WP_003026803.1 NZ_CP110958:53658-54140 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT264604 WP_003026799.1 NZ_CP110958:53404-53670 [Klebsiella pneumoniae subsp. pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References