Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4045547..4046166 Replicon chromosome
Accession NZ_CP110957
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-395/19

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPY03_RS20265 Protein ID WP_002892050.1
Coordinates 4045948..4046166 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPY03_RS20260 Protein ID WP_002892066.1
Coordinates 4045547..4045921 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY03_RS20250 (NPY03_20250) 4040699..4041892 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NPY03_RS20255 (NPY03_20255) 4041915..4045061 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NPY03_RS20260 (NPY03_20260) 4045547..4045921 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPY03_RS20265 (NPY03_20265) 4045948..4046166 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NPY03_RS20270 (NPY03_20270) 4046325..4046891 + 567 WP_002892030.1 maltose O-acetyltransferase -
NPY03_RS20275 (NPY03_20275) 4046863..4047003 - 141 WP_004147370.1 hypothetical protein -
NPY03_RS20280 (NPY03_20280) 4047024..4047494 + 471 WP_002892026.1 YlaC family protein -
NPY03_RS20285 (NPY03_20285) 4047469..4048920 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NPY03_RS20290 (NPY03_20290) 4049021..4049719 + 699 WP_002892021.1 GNAT family protein -
NPY03_RS20295 (NPY03_20295) 4049716..4049856 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPY03_RS20300 (NPY03_20300) 4049856..4050119 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T264599 WP_002892050.1 NZ_CP110957:4045948-4046166 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT264599 WP_002892066.1 NZ_CP110957:4045547-4045921 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References