Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 4045649..4046268 | Replicon | chromosome |
| Accession | NZ_CP110952 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-394/19 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | R8WYV2 |
| Locus tag | NPY09_RS20265 | Protein ID | WP_002892050.1 |
| Coordinates | 4046050..4046268 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | J2DPF6 |
| Locus tag | NPY09_RS20260 | Protein ID | WP_002892066.1 |
| Coordinates | 4045649..4046023 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPY09_RS20250 (NPY09_20250) | 4040801..4041994 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NPY09_RS20255 (NPY09_20255) | 4042017..4045163 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| NPY09_RS20260 (NPY09_20260) | 4045649..4046023 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
| NPY09_RS20265 (NPY09_20265) | 4046050..4046268 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
| NPY09_RS20270 (NPY09_20270) | 4046427..4046993 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
| NPY09_RS20275 (NPY09_20275) | 4046965..4047105 | - | 141 | WP_004147370.1 | hypothetical protein | - |
| NPY09_RS20280 (NPY09_20280) | 4047126..4047596 | + | 471 | WP_002892026.1 | YlaC family protein | - |
| NPY09_RS20285 (NPY09_20285) | 4047571..4049022 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
| NPY09_RS20290 (NPY09_20290) | 4049123..4049821 | + | 699 | WP_002892021.1 | GNAT family protein | - |
| NPY09_RS20295 (NPY09_20295) | 4049818..4049958 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
| NPY09_RS20300 (NPY09_20300) | 4049958..4050221 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264583 WP_002892050.1 NZ_CP110952:4046050-4046268 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT264583 WP_002892066.1 NZ_CP110952:4045649-4046023 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2P8K6F2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GJ93 |