Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 84108..84751 Replicon plasmid pIT-79-FIIK2_CZA
Accession NZ_CP110949
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-79/19

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NPY20_RS27880 Protein ID WP_001044770.1
Coordinates 84108..84524 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NPY20_RS27885 Protein ID WP_001261282.1
Coordinates 84521..84751 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY20_RS27845 (NPY20_27845) 79652..79888 - 237 WP_000993386.1 broad-spectrum mercury transporter MerE -
NPY20_RS27850 (NPY20_27850) 79885..80247 - 363 WP_001277456.1 mercury resistance co-regulator MerD -
NPY20_RS27855 (NPY20_27855) 80265..81959 - 1695 WP_000105636.1 mercury(II) reductase -
NPY20_RS27860 (NPY20_27860) 82011..82433 - 423 WP_001340589.1 organomercurial transporter MerC -
NPY20_RS27865 (NPY20_27865) 82469..82573 - 105 Protein_78 mercuric transport protein periplasmic component -
NPY20_RS27870 (NPY20_27870) 82598..83312 - 715 Protein_79 IS1 family transposase -
NPY20_RS27875 (NPY20_27875) 83345..84034 - 690 Protein_80 AAA family ATPase -
NPY20_RS27880 (NPY20_27880) 84108..84524 - 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NPY20_RS27885 (NPY20_27885) 84521..84751 - 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NPY20_RS27890 (NPY20_27890) 84708..85169 + 462 WP_072093212.1 hypothetical protein -
NPY20_RS27895 (NPY20_27895) 85656..85964 + 309 WP_004152336.1 hypothetical protein -
NPY20_RS27900 (NPY20_27900) 85992..86321 + 330 WP_004152337.1 hypothetical protein -
NPY20_RS27905 (NPY20_27905) 86347..86745 + 399 WP_004171440.1 hypothetical protein -
NPY20_RS27910 (NPY20_27910) 86752..87084 + 333 WP_004152339.1 hypothetical protein -
NPY20_RS27915 (NPY20_27915) 87084..87866 + 783 WP_004152340.1 site-specific integrase -
NPY20_RS27920 (NPY20_27920) 89300..89521 - 222 WP_266059048.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 89641..90909 1268
- inside Non-Mobilizable plasmid blaTEM-1A / blaOXA-9 / blaKPC-3 - 1..133656 133656


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T264573 WP_001044770.1 NZ_CP110949:c84524-84108 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT264573 WP_001261282.1 NZ_CP110949:c84751-84521 [Klebsiella pneumoniae subsp. pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References