Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4045548..4046167 | Replicon | chromosome |
Accession | NZ_CP110947 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-79/19 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NPY20_RS20265 | Protein ID | WP_002892050.1 |
Coordinates | 4045949..4046167 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NPY20_RS20260 | Protein ID | WP_002892066.1 |
Coordinates | 4045548..4045922 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPY20_RS20250 (NPY20_20250) | 4040700..4041893 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NPY20_RS20255 (NPY20_20255) | 4041916..4045062 | + | 3147 | WP_002892069.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NPY20_RS20260 (NPY20_20260) | 4045548..4045922 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NPY20_RS20265 (NPY20_20265) | 4045949..4046167 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NPY20_RS20270 (NPY20_20270) | 4046326..4046892 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NPY20_RS20275 (NPY20_20275) | 4046864..4047004 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NPY20_RS20280 (NPY20_20280) | 4047025..4047495 | + | 471 | WP_002892026.1 | YlaC family protein | - |
NPY20_RS20285 (NPY20_20285) | 4047470..4048921 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
NPY20_RS20290 (NPY20_20290) | 4049022..4049720 | + | 699 | WP_002892021.1 | GNAT family protein | - |
NPY20_RS20295 (NPY20_20295) | 4049717..4049857 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NPY20_RS20300 (NPY20_20300) | 4049857..4050120 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T264567 WP_002892050.1 NZ_CP110947:4045949-4046167 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT264567 WP_002892066.1 NZ_CP110947:4045548-4045922 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |