Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 17449..18092 | Replicon | plasmid pIT-1873-FIIK1 |
Accession | NZ_CP110943 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-1873/18 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | NPY10_RS27585 | Protein ID | WP_001044770.1 |
Coordinates | 17676..18092 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | NPY10_RS27580 | Protein ID | WP_001261282.1 |
Coordinates | 17449..17679 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPY10_RS27540 (NPY10_27540) | 12647..13120 | + | 474 | WP_004152341.1 | YkgJ family cysteine cluster protein | - |
NPY10_RS27545 (NPY10_27545) | 13212..13442 | + | 231 | WP_011977773.1 | hypothetical protein | - |
NPY10_RS27550 (NPY10_27550) | 14334..15116 | - | 783 | WP_004152340.1 | site-specific integrase | - |
NPY10_RS27555 (NPY10_27555) | 15116..15448 | - | 333 | WP_004152339.1 | hypothetical protein | - |
NPY10_RS27560 (NPY10_27560) | 15455..15853 | - | 399 | WP_004171440.1 | hypothetical protein | - |
NPY10_RS27565 (NPY10_27565) | 15879..16208 | - | 330 | WP_004152337.1 | hypothetical protein | - |
NPY10_RS27570 (NPY10_27570) | 16236..16544 | - | 309 | WP_004152336.1 | hypothetical protein | - |
NPY10_RS27575 (NPY10_27575) | 17031..17492 | - | 462 | WP_072093212.1 | hypothetical protein | - |
NPY10_RS27580 (NPY10_27580) | 17449..17679 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NPY10_RS27585 (NPY10_27585) | 17676..18092 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NPY10_RS27590 (NPY10_27590) | 18166..18855 | + | 690 | Protein_19 | AAA family ATPase | - |
NPY10_RS27595 (NPY10_27595) | 18910..19607 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
NPY10_RS27600 (NPY10_27600) | 19623..19733 | + | 111 | Protein_21 | mercuric transport protein periplasmic component | - |
NPY10_RS27605 (NPY10_27605) | 19769..20191 | + | 423 | WP_001340589.1 | organomercurial transporter MerC | - |
NPY10_RS27610 (NPY10_27610) | 20243..21937 | + | 1695 | WP_000105636.1 | mercury(II) reductase | - |
NPY10_RS27615 (NPY10_27615) | 21955..22317 | + | 363 | WP_001277456.1 | mercury resistance co-regulator MerD | - |
NPY10_RS27620 (NPY10_27620) | 22314..22550 | + | 237 | WP_000993386.1 | broad-spectrum mercury transporter MerE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaTEM-1A / blaKPC-3 / blaOXA-9 / aac(6')-Ib | - | 1..120296 | 120296 | |
- | flank | IS/Tn | - | - | 11208..12527 | 1319 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T264557 WP_001044770.1 NZ_CP110943:17676-18092 [Klebsiella pneumoniae subsp. pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |