Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1227126..1227745 Replicon chromosome
Accession NZ_CP110941
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-1873/18

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NPY10_RS05915 Protein ID WP_002892050.1
Coordinates 1227126..1227344 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NPY10_RS05920 Protein ID WP_002892066.1
Coordinates 1227371..1227745 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY10_RS05880 (NPY10_05880) 1223173..1223436 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NPY10_RS05885 (NPY10_05885) 1223436..1223576 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NPY10_RS05890 (NPY10_05890) 1223573..1224271 - 699 WP_002892021.1 GNAT family protein -
NPY10_RS05895 (NPY10_05895) 1224372..1225823 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NPY10_RS05900 (NPY10_05900) 1225798..1226268 - 471 WP_002892026.1 YlaC family protein -
NPY10_RS05905 (NPY10_05905) 1226289..1226429 + 141 WP_004147370.1 hypothetical protein -
NPY10_RS05910 (NPY10_05910) 1226401..1226967 - 567 WP_002892030.1 maltose O-acetyltransferase -
NPY10_RS05915 (NPY10_05915) 1227126..1227344 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NPY10_RS05920 (NPY10_05920) 1227371..1227745 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NPY10_RS05925 (NPY10_05925) 1228231..1231377 - 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NPY10_RS05930 (NPY10_05930) 1231400..1232593 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T264545 WP_002892050.1 NZ_CP110941:c1227344-1227126 [Klebsiella pneumoniae subsp. pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT264545 WP_002892066.1 NZ_CP110941:c1227745-1227371 [Klebsiella pneumoniae subsp. pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References