Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 53663..54399 | Replicon | plasmid pIT-1736-FIIFIB |
Accession | NZ_CP110938 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-1736/18 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | L7SZ15 |
Locus tag | NPY06_RS27950 | Protein ID | WP_003026803.1 |
Coordinates | 53917..54399 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | NPY06_RS27945 | Protein ID | WP_003026799.1 |
Coordinates | 53663..53929 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPY06_RS27900 (NPY06_27900) | 49725..50087 | - | 363 | WP_004152100.1 | arsenite efflux transporter metallochaperone ArsD | - |
NPY06_RS27905 (NPY06_27905) | 50137..50487 | - | 351 | WP_004152101.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
NPY06_RS27910 (NPY06_27910) | 50845..51114 | + | 270 | WP_004152102.1 | hypothetical protein | - |
NPY06_RS27915 (NPY06_27915) | 51102..51677 | + | 576 | WP_004152103.1 | hypothetical protein | - |
NPY06_RS27920 (NPY06_27920) | 51708..52202 | + | 495 | WP_004152104.1 | DNA-binding protein | - |
NPY06_RS27925 (NPY06_27925) | 52246..52614 | + | 369 | WP_004152105.1 | hypothetical protein | - |
NPY06_RS27930 (NPY06_27930) | 52648..52851 | + | 204 | WP_004152106.1 | HHA domain-containing protein | - |
NPY06_RS27935 (NPY06_27935) | 52900..53157 | + | 258 | WP_004152107.1 | hypothetical protein | - |
NPY06_RS27940 (NPY06_27940) | 53233..53487 | + | 255 | WP_004152108.1 | hypothetical protein | - |
NPY06_RS27945 (NPY06_27945) | 53663..53929 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
NPY06_RS27950 (NPY06_27950) | 53917..54399 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
NPY06_RS27955 (NPY06_27955) | 54611..55957 | + | 1347 | WP_020314316.1 | ISNCY family transposase | - |
NPY06_RS27960 (NPY06_27960) | 56118..56249 | + | 132 | WP_004218042.1 | hypothetical protein | - |
NPY06_RS27965 (NPY06_27965) | 56458..57623 | - | 1166 | Protein_59 | IS3 family transposase | - |
NPY06_RS27970 (NPY06_27970) | 57800..58762 | - | 963 | WP_004152113.1 | zinc metalloprotease HtpX | - |
NPY06_RS27975 (NPY06_27975) | 58749..59237 | - | 489 | WP_004152114.1 | phosphate-starvation-inducible PsiE family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(3')-Ia / mph(A) / sul1 / qacE / aadA2 / dfrA12 / catA1 | - | 1..205140 | 205140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T264541 WP_003026803.1 NZ_CP110938:53917-54399 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2GNW6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |