Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) tacAT/DUF1778(antitoxin)
Location 53663..54399 Replicon plasmid pIT-1736-FIIFIB
Accession NZ_CP110938
Organism Klebsiella pneumoniae subsp. pneumoniae strain LC-1736/18

Toxin (Protein)


Gene name tacT Uniprot ID L7SZ15
Locus tag NPY06_RS27950 Protein ID WP_003026803.1
Coordinates 53917..54399 (+) Length 161 a.a.

Antitoxin (Protein)


Gene name tacA Uniprot ID L7SZ29
Locus tag NPY06_RS27945 Protein ID WP_003026799.1
Coordinates 53663..53929 (+) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NPY06_RS27900 (NPY06_27900) 49725..50087 - 363 WP_004152100.1 arsenite efflux transporter metallochaperone ArsD -
NPY06_RS27905 (NPY06_27905) 50137..50487 - 351 WP_004152101.1 As(III)-sensing metalloregulatory transcriptional repressor ArsR -
NPY06_RS27910 (NPY06_27910) 50845..51114 + 270 WP_004152102.1 hypothetical protein -
NPY06_RS27915 (NPY06_27915) 51102..51677 + 576 WP_004152103.1 hypothetical protein -
NPY06_RS27920 (NPY06_27920) 51708..52202 + 495 WP_004152104.1 DNA-binding protein -
NPY06_RS27925 (NPY06_27925) 52246..52614 + 369 WP_004152105.1 hypothetical protein -
NPY06_RS27930 (NPY06_27930) 52648..52851 + 204 WP_004152106.1 HHA domain-containing protein -
NPY06_RS27935 (NPY06_27935) 52900..53157 + 258 WP_004152107.1 hypothetical protein -
NPY06_RS27940 (NPY06_27940) 53233..53487 + 255 WP_004152108.1 hypothetical protein -
NPY06_RS27945 (NPY06_27945) 53663..53929 + 267 WP_003026799.1 DUF1778 domain-containing protein Antitoxin
NPY06_RS27950 (NPY06_27950) 53917..54399 + 483 WP_003026803.1 GNAT family N-acetyltransferase Toxin
NPY06_RS27955 (NPY06_27955) 54611..55957 + 1347 WP_020314316.1 ISNCY family transposase -
NPY06_RS27960 (NPY06_27960) 56118..56249 + 132 WP_004218042.1 hypothetical protein -
NPY06_RS27965 (NPY06_27965) 56458..57623 - 1166 Protein_59 IS3 family transposase -
NPY06_RS27970 (NPY06_27970) 57800..58762 - 963 WP_004152113.1 zinc metalloprotease HtpX -
NPY06_RS27975 (NPY06_27975) 58749..59237 - 489 WP_004152114.1 phosphate-starvation-inducible PsiE family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(3')-Ia / mph(A) / sul1 / qacE / aadA2 / dfrA12 / catA1 - 1..205140 205140


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

GNAT domain

(45-149)

Antitoxin

Vibrio phage ICP1, Orf50

(6-82)


Sequences

Toxin        


Download         Length: 161 a.a.        Molecular weight: 17353.97 Da        Isoelectric Point: 9.5822

>T264541 WP_003026803.1 NZ_CP110938:53917-54399 [Klebsiella pneumoniae subsp. pneumoniae]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP

Download         Length: 483 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 10147.59 Da        Isoelectric Point: 4.5256

>AT264541 WP_003026799.1 NZ_CP110938:53663-53929 [Klebsiella pneumoniae subsp. pneumoniae]
MKSDVQLNLRAKESQRALIDAAAEILHKSRTDFILEMACKAAENVILDRRVFNFNDEQYAEFIDMLDAPVEDEPAINKLL
ARKPQWDV

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0J2GNW6

Antitoxin

Source ID Structure
AlphaFold DB A0A1Q8YL66

References