Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 4417343..4418000 | Replicon | chromosome |
Accession | NZ_CP110936 | ||
Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-1736/18 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | NPY06_RS21795 | Protein ID | WP_002916310.1 |
Coordinates | 4417343..4417753 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NPY06_RS21800 | Protein ID | WP_002916312.1 |
Coordinates | 4417734..4418000 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPY06_RS21775 (NPY06_21775) | 4413343..4415076 | - | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NPY06_RS21780 (NPY06_21780) | 4415082..4415795 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NPY06_RS21785 (NPY06_21785) | 4415818..4416714 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NPY06_RS21790 (NPY06_21790) | 4416815..4417336 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
NPY06_RS21795 (NPY06_21795) | 4417343..4417753 | - | 411 | WP_002916310.1 | protein YgfX | Toxin |
NPY06_RS21800 (NPY06_21800) | 4417734..4418000 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NPY06_RS21805 (NPY06_21805) | 4418246..4419229 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
NPY06_RS21810 (NPY06_21810) | 4419380..4420039 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
NPY06_RS21815 (NPY06_21815) | 4420203..4420514 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
NPY06_RS21820 (NPY06_21820) | 4420564..4421292 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NPY06_RS21825 (NPY06_21825) | 4421411..4422844 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T264535 WP_002916310.1 NZ_CP110936:c4417753-4417343 [Klebsiella pneumoniae subsp. pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |