Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 510362..510878 | Replicon | chromosome |
| Accession | NZ_CP110936 | ||
| Organism | Klebsiella pneumoniae subsp. pneumoniae strain LC-1736/18 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | NPY06_RS02465 | Protein ID | WP_002886902.1 |
| Coordinates | 510594..510878 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | NPY06_RS02460 | Protein ID | WP_002886901.1 |
| Coordinates | 510362..510604 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NPY06_RS02445 (NPY06_02445) | 506391..507131 | + | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
| NPY06_RS02450 (NPY06_02450) | 507197..508351 | + | 1155 | WP_002886900.1 | lactonase family protein | - |
| NPY06_RS02455 (NPY06_02455) | 508374..510284 | + | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| NPY06_RS02460 (NPY06_02460) | 510362..510604 | + | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NPY06_RS02465 (NPY06_02465) | 510594..510878 | + | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NPY06_RS02470 (NPY06_02470) | 510882..511346 | - | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| NPY06_RS02475 (NPY06_02475) | 511587..513725 | - | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| NPY06_RS02480 (NPY06_02480) | 514082..514825 | - | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| NPY06_RS02485 (NPY06_02485) | 514828..515001 | - | 174 | WP_002886906.1 | hypothetical protein | - |
| NPY06_RS02490 (NPY06_02490) | 515131..515394 | + | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T264527 WP_002886902.1 NZ_CP110936:510594-510878 [Klebsiella pneumoniae subsp. pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GMH2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |