Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 27807..28332 Replicon plasmid unnamed
Accession NZ_CP110935
Organism Salmonella enterica strain CVCC 519

Toxin (Protein)


Gene name ccdB Uniprot ID Q9EUE9
Locus tag ORG43_RS23430 Protein ID WP_001541545.1
Coordinates 28027..28332 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID M7S5D0
Locus tag ORG43_RS23425 Protein ID WP_000813641.1
Coordinates 27807..28025 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORG43_RS23395 (ORG43_23395) 23459..23845 + 387 WP_001541549.1 YgiW/YdeI family stress tolerance OB fold protein -
ORG43_RS23400 (ORG43_23400) 23898..24017 + 120 Protein_27 recombinase -
ORG43_RS23405 (ORG43_23405) 24348..25337 - 990 WP_000461383.1 RepB family plasmid replication initiator protein -
ORG43_RS23410 (ORG43_23410) 25831..26126 - 296 Protein_29 cytoplasmic protein -
ORG43_RS23415 (ORG43_23415) 26138..26566 + 429 Protein_30 hypothetical protein -
ORG43_RS23420 (ORG43_23420) 26610..27131 - 522 WP_079961209.1 hypothetical protein -
ORG43_RS23425 (ORG43_23425) 27807..28025 + 219 WP_000813641.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
ORG43_RS23430 (ORG43_23430) 28027..28332 + 306 WP_001541545.1 type II toxin-antitoxin system toxin CcdB Toxin
ORG43_RS23435 (ORG43_23435) 28334..28624 + 291 WP_001266176.1 hypothetical protein -
ORG43_RS23440 (ORG43_23440) 28621..29142 + 522 WP_000198608.1 hypothetical protein -
ORG43_RS23445 (ORG43_23445) 29177..29959 + 783 WP_000082169.1 site-specific integrase -
ORG43_RS23450 (ORG43_23450) 29968..30519 + 552 WP_000545754.1 EAL domain-containing protein -
ORG43_RS23455 (ORG43_23455) 30747..31172 + 426 WP_001134680.1 CaiF/GrlA family transcriptional regulator -
ORG43_RS23460 (ORG43_23460) 31166..31651 + 486 WP_000905606.1 membrane protein -
ORG43_RS23465 (ORG43_23465) 31904..32491 + 588 WP_001541543.1 LysM peptidoglycan-binding domain-containing protein -
ORG43_RS23470 (ORG43_23470) 32386..32930 + 545 Protein_41 inverse autotransporter beta domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefD / pefC / pefA / pefB / spvC / spvB 1..49544 49544


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11659.54 Da        Isoelectric Point: 5.8604

>T264525 WP_001541545.1 NZ_CP110935:28027-28332 [Salmonella enterica]
MQFKVYTCKRESRYRLFVDVQSDIIDTPERRMAVPLVSARLLSEKVPRDLYPVMHIGDEPYRLLTTDMTSVPATVIGEEV
ADLSLRENDIKNAINLMFRGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8314.16 Da        Isoelectric Point: 4.5203

>AT264525 WP_000813641.1 NZ_CP110935:27807-28025 [Salmonella enterica]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTMQNEARRLRAERWQEENREGMAEVASFIEANGSFADDNRNW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q9EUE9

Antitoxin

Source ID Structure
AlphaFold DB A0A656ICA6

References