Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 10758..11383 Replicon plasmid unnamed
Accession NZ_CP110935
Organism Salmonella enterica strain CVCC 519

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag ORG43_RS23315 Protein ID WP_000911322.1
Coordinates 10758..11156 (-) Length 133 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8F2UQ48
Locus tag ORG43_RS23320 Protein ID WP_000450263.1
Coordinates 11156..11383 (-) Length 76 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ORG43_RS23295 (ORG43_23295) 6214..6915 + 702 WP_148201696.1 hypothetical protein -
ORG43_RS23300 (ORG43_23300) 6912..7154 + 243 WP_024131413.1 hypothetical protein -
ORG43_RS23305 (ORG43_23305) 7457..8188 + 732 WP_001541558.1 conjugal transfer complement resistance protein TraT -
ORG43_RS23310 (ORG43_23310) 8560..10749 + 2190 WP_079961212.1 type IV conjugative transfer system coupling protein TraD -
ORG43_RS23315 (ORG43_23315) 10758..11156 - 399 WP_000911322.1 type II toxin-antitoxin system VapC family toxin Toxin
ORG43_RS23320 (ORG43_23320) 11156..11383 - 228 WP_000450263.1 toxin-antitoxin system antitoxin VapB Antitoxin
ORG43_RS23325 (ORG43_23325) 11465..13955 + 2491 Protein_12 conjugative relaxase -
ORG43_RS23330 (ORG43_23330) 13975..14715 + 741 WP_000177630.1 conjugal transfer pilus acetylase TraX -
ORG43_RS23335 (ORG43_23335) 14770..15333 + 564 WP_000139307.1 fertility inhibition protein FinO -
ORG43_RS23340 (ORG43_23340) 15450..15723 + 274 Protein_15 disulfide bond formation protein DsbA -
ORG43_RS23345 (ORG43_23345) 15715..15894 + 180 WP_223163853.1 disulfide bond formation protein DsbA -
ORG43_RS23350 (ORG43_23350) 15945..16114 + 170 Protein_17 phospholipase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - pefD / pefC / pefA / pefB / spvC / spvB 1..49544 49544


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-125)

Antitoxin

SpoVT-AbrB domain

(7-51)


Sequences

Toxin        


Download         Length: 133 a.a.        Molecular weight: 14887.13 Da        Isoelectric Point: 8.5264

>T264524 WP_000911322.1 NZ_CP110935:c11156-10758 [Salmonella enterica]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLDVLDYDTPAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVGGLRTEDWS

Download         Length: 399 bp

Antitoxin


Download         Length: 76 a.a.        Molecular weight: 8532.53 Da        Isoelectric Point: 4.7513

>AT264524 WP_000450263.1 NZ_CP110935:c11383-11156 [Salmonella enterica]
METSVFLSNRSQAVRLPKAVALPEHVKRVEVIAVGRTRIITPAGESWDEWFDGNNVSADFMDNREQPSVQERESF

Download         Length: 228 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References