Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3368438..3369058 | Replicon | chromosome |
| Accession | NZ_CP110934 | ||
| Organism | Salmonella enterica strain CVCC 519 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | V1H8E6 |
| Locus tag | ORG43_RS16660 | Protein ID | WP_001280991.1 |
| Coordinates | 3368840..3369058 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V1H4V6 |
| Locus tag | ORG43_RS16655 | Protein ID | WP_000344807.1 |
| Coordinates | 3368438..3368812 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG43_RS16645 (3363577) | 3363577..3364770 | + | 1194 | WP_023235518.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| ORG43_RS16650 (3364793) | 3364793..3367942 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
| ORG43_RS16655 (3368438) | 3368438..3368812 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
| ORG43_RS16660 (3368840) | 3368840..3369058 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
| ORG43_RS16665 (3369237) | 3369237..3369788 | + | 552 | WP_001278793.1 | maltose O-acetyltransferase | - |
| ORG43_RS16670 (3369906) | 3369906..3370376 | + | 471 | WP_000136183.1 | YlaC family protein | - |
| ORG43_RS16675 (3370432) | 3370432..3370572 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
| ORG43_RS16680 (3370578) | 3370578..3370838 | - | 261 | WP_000801415.1 | type B 50S ribosomal protein L31 | - |
| ORG43_RS16685 (3371063) | 3371063..3372472 | + | 1410 | WP_038393950.1 | EAL domain-containing protein | - |
| ORG43_RS16695 (3372703) | 3372703..3373092 | + | 390 | WP_000961285.1 | MGMT family protein | - |
| ORG43_RS16700 (3373125) | 3373125..3373694 | - | 570 | WP_000779802.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T264519 WP_001280991.1 NZ_CP110934:3368840-3369058 [Salmonella enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT264519 WP_000344807.1 NZ_CP110934:3368438-3368812 [Salmonella enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|