Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 950190..951004 | Replicon | chromosome |
| Accession | NZ_CP110934 | ||
| Organism | Salmonella enterica strain CVCC 519 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | ORG43_RS04550 | Protein ID | WP_000971655.1 |
| Coordinates | 950190..950717 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | ORG43_RS04555 | Protein ID | WP_000855694.1 |
| Coordinates | 950714..951004 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG43_RS04520 (946489) | 946489..946887 | + | 399 | Protein_885 | cytoplasmic protein | - |
| ORG43_RS04525 (947078) | 947078..947317 | + | 240 | Protein_886 | hypothetical protein | - |
| ORG43_RS04530 (947474) | 947474..948142 | + | 669 | WP_001540791.1 | hypothetical protein | - |
| ORG43_RS04535 (948169) | 948169..948663 | + | 495 | WP_001540790.1 | hypothetical protein | - |
| ORG43_RS04540 (948908) | 948908..949564 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| ORG43_RS04545 (949902) | 949902..950117 | + | 216 | Protein_890 | IS5/IS1182 family transposase | - |
| ORG43_RS04550 (950190) | 950190..950717 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| ORG43_RS04555 (950714) | 950714..951004 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| ORG43_RS04560 (951274) | 951274..951459 | - | 186 | Protein_893 | IS3 family transposase | - |
| ORG43_RS04565 (951877) | 951877..952320 | - | 444 | WP_000715102.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| ORG43_RS04570 (952776) | 952776..953426 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
| ORG43_RS04575 (953423) | 953423..955111 | + | 1689 | WP_001540787.1 | type III secretion system outer membrane ring protein InvG | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 949977..958739 | 8762 | |
| - | flank | IS/Tn | - | - | 949977..950117 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T264513 WP_000971655.1 NZ_CP110934:c950717-950190 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |