Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 815157..815817 | Replicon | chromosome |
| Accession | NZ_CP110934 | ||
| Organism | Salmonella enterica strain CVCC 519 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | ORG43_RS03865 | Protein ID | WP_000244756.1 |
| Coordinates | 815157..815570 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | ORG43_RS03870 | Protein ID | WP_000351186.1 |
| Coordinates | 815551..815817 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ORG43_RS03845 (811098) | 811098..812831 | - | 1734 | WP_000813392.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ORG43_RS03850 (812837) | 812837..813550 | - | 714 | WP_001540860.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ORG43_RS03855 (813574) | 813574..814470 | - | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| ORG43_RS03860 (814583) | 814583..815104 | + | 522 | WP_001055885.1 | flavodoxin FldB | - |
| ORG43_RS03865 (815157) | 815157..815570 | - | 414 | WP_000244756.1 | protein YgfX | Toxin |
| ORG43_RS03870 (815551) | 815551..815817 | - | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| ORG43_RS03875 (816067) | 816067..817047 | + | 981 | WP_000874173.1 | tRNA-modifying protein YgfZ | - |
| ORG43_RS03880 (817163) | 817163..817822 | - | 660 | WP_023235227.1 | hemolysin III family protein | - |
| ORG43_RS03885 (817986) | 817986..818297 | - | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| ORG43_RS03890 (818455) | 818455..819888 | + | 1434 | WP_001230139.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T264512 WP_000244756.1 NZ_CP110934:c815570-815157 [Salmonella enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |